KEGG   Helicobacter pylori 2018: hp2018_1238Help
Entry
hp2018_1238       CDS       T01914                                 

Definition
(GenBank) Phosphomannomutase/Phosphoglucomutase/Phosphoglu cosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpw  Helicobacter pylori 2018
Pathway
hpw00010  Glycolysis / Gluconeogenesis
hpw00030  Pentose phosphate pathway
hpw00051  Fructose and mannose metabolism
hpw00052  Galactose metabolism
hpw00230  Purine metabolism
hpw00500  Starch and sucrose metabolism
hpw00520  Amino sugar and nucleotide sugar metabolism
hpw00521  Streptomycin biosynthesis
hpw01100  Metabolic pathways
hpw01110  Biosynthesis of secondary metabolites
hpw01120  Microbial metabolism in diverse environments
hpw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    hp2018_1238
   00030 Pentose phosphate pathway
    hp2018_1238
   00051 Fructose and mannose metabolism
    hp2018_1238
   00052 Galactose metabolism
    hp2018_1238
   00500 Starch and sucrose metabolism
    hp2018_1238
   00520 Amino sugar and nucleotide sugar metabolism
    hp2018_1238
  Nucleotide metabolism
   00230 Purine metabolism
    hp2018_1238
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    hp2018_1238
Enzymes [BR:hpw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     hp2018_1238
    5.4.2.8  phosphomannomutase
     hp2018_1238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADZ51955
Position
1260792..1262168
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDENTAFSIGVELGKIMREYDKSVFVGHDARVHGRFLFEALS
AGLQSSSLKVYDLGLIPTPVAYFAAFNEINGIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEKKPLKETPKKVNALEAYHRYLIKDFKHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMRENAILIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLTETNAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQSPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQEALKNPPSHFPTIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETIALEYKRALLNLLEK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatacgacattaggggcatttaccccaccactttagat
gaaaatacggcttttagtatcggcgtggagttggggaaaatcatgcgagaatacgataaa
agcgtgtttgtagggcatgacgcaagggtgcatgggcgctttttgtttgaagctttgagc
gcggggctgcaatcaagcagcctgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatcaatggcattcaatgccctaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggacattcaggctttaaaagacacgcttttaaatgctaaacatgaaaaa
aaacccctaaaagaaacgccaaagaaagtcaatgccctagaagcgtatcatcgctatttg
atcaaggattttaagcatttaaaaaatcttaaatataaaatcgccctggattttggtaat
ggcgtgggagcgttaggattagagccgattttaaaggctttaaacattgattttagcagc
ctttatagcgatcctgatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagatttagaaaaacacatgcgagaaaacgctattttgataggctttgctttt
gatggcgatgcggataggattgcgatgctaagctctcatcatatttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccttttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgattaatacttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaagctcacagaaactaatgcacattttgcg
gctgaaatgagcgggcatatcttttttaaagaacgctattttggctatgatgacgctctt
tacgcatgtttaagggctttggagttattgcttgaacaaagtccaagcgacttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcacaacttacaagaagcgcttaaaaacccgccaagccat
ttccctacaatcaaagaaatcatcagcattgatggcgtgagagtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccaccccctatttagtcagccgctttgaaggcaag
gatgaaacaatagcgttagaatataaaagggcgttgctcaatttgttagagaagtag

DBGET integrated database retrieval system