KEGG   Helicobacter pylori 2018: hp2018_1243Help
Entry
hp2018_1243       CDS       T01914                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase/Phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hpw  Helicobacter pylori 2018
Pathway
hpw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpw01100  Metabolic pathways
hpw01110  Biosynthesis of secondary metabolites
hpw01130  Biosynthesis of antibiotics
hpw01230  Biosynthesis of amino acids
Module
hpw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpw00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    hp2018_1243 (trpC)
Enzymes [BR:hpw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     hp2018_1243 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     hp2018_1243 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADZ51960
Position
complement(1265798..1267156)
Genome map
AA seq 452 aa AA seqDB search
MPSVLENILKDKLLEVSALKKNHALPINITPSDRDFKKALLEKRTSFILECKKASPSKGL
IRKDFDLLEITKTYEKFASCVSVLADSKHFLGSYENIKIVSQHSTKPILCKDFIIDAFQI
KLARVMGANAVLLMLSVLDDKNYLGLFNLAKSLNMSVLTEVSNKQEIERLLKLQYDIIGI
NNRDLHTLKTDIDHTLELRPLLPKDAIIISESGIYSHAQIKALAPYVSGFLVGSSLMKEK
DLKKACTKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAV
KKLDFVGVFVKDKIKKIQKIAKKLDLKAVQLYGYSPKEIAQLKKSLPKTCAIWQVVSVMN
AKDLAPKAKETSLILYDTKGDKMGGNGVSFDWEILENVKTPFMLAGGLNLDNIQKALKVK
ALGLDFNSGLEISPGIKNKDKIKQLARILREY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtgttagaaaacatccttaaagacaaactcctagaagtctctgcgcttaaa
aaaaatcacgctttaccgataaacataaccccaagcgacagggattttaaaaaagcgtta
ttggaaaaaaggacaagctttattttagagtgtaaaaaagcatcgccctccaaaggtttg
atcagaaaagattttgacttgttggaaataacgaaaacttatgaaaaatttgcctcttgc
gtttcagttttagccgattctaaacattttttaggctcttatgaaaacattaagatcgtt
tcgcagcattccaccaagcccattttgtgtaaagattttatcattgacgcttttcagatc
aaactcgctagggttatgggagctaatgcggtgcttttaatgttgagcgtgttagatgat
aaaaactatttagggctctttaatctcgccaaatccttaaacatgagcgttttaactgaa
gtttccaacaagcaagaaattgagcgcttgctcaaactccaatacgacattataggtatc
aataacagggatttacacaccttgaaaaccgatattgaccacacgctggaattacgcccc
ctgttgcctaaagacgcgatcattatcagcgagtccggtatttattcgcatgcgcaaatc
aaagccctagccccttatgtgagtggctttttagtgggcagctctttaatgaaagaaaag
gatttgaaaaaagcgtgcactaaattgattttaggcgaaaataaagtgtgcgggcttaca
aggattaaagacgctaaagccgtttataaaaaccattttatttatgggggtttgattttt
gaaaaatcttcgccccgatacatcaagcctaaagaagccttaaagatcacaaaagcggtt
aaaaaactggattttgtaggcgtgtttgtgaaagataaaatcaaaaaaatccaaaaaatc
gccaaaaaacttgatttaaaagcggtgcagctttatggctattcgcctaaagaaatcgct
caattgaaaaaatcgctccctaaaacttgcgcgatctggcaagtagtgagcgtgatgaac
gctaaagatttagcgcctaaagctaaagagacctctctaatcttatacgacactaagggg
gataaaatgggaggcaatggcgtgagttttgattgggaaattttagaaaatgtcaaaacg
cctttcatgctagctggtgggcttaatttggataatattcaaaaagccttgaaagttaaa
gcgttgggtttggatttcaattcaggtttagaaataagccccgggattaaaaataaggat
aaaatcaagcaattagcccgaattttaagagagtattaa

DBGET integrated database retrieval system