KEGG   Helicobacter pylori 83: HMPREF0462_0247Help
Entry
HMPREF0462_0247   CDS       T01915                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpx  Helicobacter pylori 83
Pathway
hpx00010  Glycolysis / Gluconeogenesis
hpx00051  Fructose and mannose metabolism
hpx01100  Metabolic pathways
hpx01110  Biosynthesis of secondary metabolites
hpx01120  Microbial metabolism in diverse environments
hpx01130  Biosynthesis of antibiotics
hpx01200  Carbon metabolism
hpx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0462_0247 (tpiA)
   00051 Fructose and mannose metabolism
    HMPREF0462_0247 (tpiA)
   00562 Inositol phosphate metabolism
    HMPREF0462_0247 (tpiA)
Enzymes [BR:hpx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF0462_0247 (tpiA)
Exosome [BR:hpx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF0462_0247 (tpiA)
  Exosomal proteins of bladder cancer cells
   HMPREF0462_0247 (tpiA)
  Exosomal proteins of melanoma cells
   HMPREF0462_0247 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEE69852
UniProt: F4D3Y6
Position
235236..235940
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIYKSHAYLEELERTLKPQHFDRVFVFPDFLGLLPNSFLHFTLGAQN
AYPKDCGAFTGEITSQHLEELKINTLLIGHSERRLLLKESPSFLKEKFDFFKSKNFKIVY
CIGEELTTREKGFKAVKEFLNEQLENIDLNYPNLVVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNVQNAKEILGIDSVDGLLIGSTSLELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgctatggctaattttaaatccgctatgcccatttataaaagccatgcg
tatttagaagaattagaaaggactttaaaaccgcagcattttgatagggtgtttgtattc
cctgattttttggggttattgcctaattcgtttttgcatttcactttaggagcgcaaaac
gcttaccctaaagattgcggagcttttaccggtgaaatcacttcacagcatttagaagaa
ctgaaaatcaacacgcttttaatagggcatagcgagaggcgattgcttttaaaggaaagc
cctagctttttgaaagaaaagtttgatttttttaaaagtaaaaattttaaaattgtctat
tgcattggcgaagaattaacgaccagagaaaagggttttaaggctgtaaaggaattttta
aacgagcaattagaaaatattgatcttaattatcctaatttagtggtggcgtatgagcct
atttgggcgattggcacaaaaaagagcgcttctttagaagatatttatctcacgcatggt
tttttaaagcaaattttaaatcaaaaaacgcccttattgtatggggggagcgtgaatgtg
caaaacgctaaagaaattttagggattgatagcgtggatggcttgttgattgggagcacg
tctttggaattagaaaattttaaaacaatcatttcgtttttataa

DBGET integrated database retrieval system