KEGG   Helicobacter pylori 83: HMPREF0462_0410Help
Entry
HMPREF0462_0410   CDS       T01915                                 

Gene name
dxs
Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
hpx  Helicobacter pylori 83
Pathway
hpx00730  Thiamine metabolism
hpx00900  Terpenoid backbone biosynthesis
hpx01100  Metabolic pathways
hpx01110  Biosynthesis of secondary metabolites
hpx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    HMPREF0462_0410 (dxs)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF0462_0410 (dxs)
Enzymes [BR:hpx01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     HMPREF0462_0410 (dxs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C E1_dh TPP_enzyme_C Rtt106_N
Motif
Other DBs
NCBI-ProteinID: AEE70015
UniProt: F4D4U0
Position
393526..395382
Genome map
AA seq 618 aa AA seqDB search
MILQNKTFDLNPNDIAGLELVCQTLRSRILEVVSANGGHLSSSLGAVELIVSMHALFDCQ
KNPFIFDTSHQAYAHKLLTGRFESFSTLRQFKGLSGFTKPSESAYDYFIAGHSSTSVSIG
VGVAKAFCLKQALGMPIALLGDGSISAGIFYEALNELGDRKYPMIMILNDNEMSISTPIG
ALSKALSQLMKGPFYQSFRSKVKKILSTLPESVNYLASRFEESFKLITPGVFFEELGINY
IGPINGHDLSAIIETLKLAKELKEPVLIHAQTLKGKGYKIAEGRYEKWHGVGPFDLDTGL
SKKSKSTILSPTEAYSNTLLELAKKDEKIVGVTAAMPSGTGLDKLIDAYPLRFFDVAIAE
QHALTSSSAMAKEGFKPFVSIYSTFLQRAYDSIVHDACISSLPIKLAIDRAGIVGEDGET
HQGLLDVSYLRSIPNMVIFAPRDNETLKNAVHFANEHHSSPCAFRYPRGSFALKEGVFEP
SGFVLGQSELLKKEGEILLIGYGNGVGRAHLVQLALKEKNIECALLDLRFLKPLDQNLSV
IIAPYQKLYVFSDNYKLGGVASAILEFLSEQNILKPVKSFEIVDEFIMHGNTALVEKSLG
LDTESLTDAILKDLGQER
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
gtgattttgcaaaataaaacttttgatttaaaccctaatgatattgcaggcttggaattg
gtgtgtcaaacgctgcgcagtcgtattttagaagtggtgagcgctaatggggggcattta
agctcttctttaggggctgtggagctgattgtaagcatgcatgccttatttgattgccaa
aaaaaccctttcatttttgacacttcacaccaggcttacgctcacaagcttttaaccggg
cgctttgaaagctttagcactctaaggcaatttaaaggtttgagcggctttactaaaccc
agcgagagcgcatacgattatttcattgccgggcatagctccacttcggtgtctataggc
gtgggggtggctaaagctttttgtttgaaacaagcgctaggcatgcccatagctttatta
ggcgatgggagcattagcgcagggattttttatgaagccttaaacgaactaggcgatagg
aaataccccatgatcatgattttgaacgataatgaaatgagtatcagcacgcctattgga
gccctatccaaagcccttagccagctgatgaaaggcccgttttaccagtctttccgctct
aaagttaaaaaaatcttaagcaccttacctgaaagcgtgaattacttagcgagccgtttt
gaagaatctttcaagctcatcaccccgggcgtgttttttgaagaattaggcattaactat
atagggcctattaatgggcatgatttgagcgcgattattgaaaccttaaaactcgccaaa
gagcttaaagagccggtgctaattcatgcgcaaaccttaaagggcaaaggctataaaatc
gctgaagggcggtatgaaaaatggcatggggtggggccttttgatttggataccggtctg
tctaaaaaatccaaaagcacgattttatcgcccactgaagcgtattctaacaccctctta
gaattagccaaaaaagatgaaaaaatcgtaggcgtaaccgctgctatgcctagcggcaca
ggattagacaaactcattgacgcttaccctttgcgcttttttgatgtcgctatcgctgaa
caacacgctttaacttctagcagcgctatggctaaagaagggtttaaaccttttgtgagt
atctattctacttttttacaaagggcttatgattccattgtgcatgacgcttgtatttct
agcttgccgattaaattagccattgatagggctgggattgtgggcgaagatggcgaaacg
caccaagggcttttagacgtgtcatatttgcgctctatccccaacatggtcatttttgcc
ccacgagataatgagactttaaaaaacgccgtgcattttgccaatgaacatcattcaagc
ccttgcgcgttccgctaccctagggggtcgtttgcactaaaagagggggtttttgagcct
agcggttttgttttagggcaaagcgaattattgaaaaaagagggcgaaattttactcatt
ggctatggtaatggcgtggggcgggcgcatttagtccaactggctttaaaggaaaaaaac
atagagtgcgcgctgttggatctcaggtttttaaagcccttagatcaaaatttaagtgtg
atcattgccccttatcaaaaactctatgtttttagcgataattacaagcttgggggggtg
gctagcgcgattttagagtttttgagcgaacaaaatattttaaagcctgttaaaagcttt
gaaatcgttgatgaatttatcatgcatgggaacaccgctttagtggaaaaatccttaggc
ttagacacagagagtttgactgacgctattttaaaagatttaggacaagagagatga

DBGET integrated database retrieval system