KEGG   Helicobacter pylori 83: HMPREF0462_0549Help
Entry
HMPREF0462_0549   CDS       T01915                                 

Gene name
rfaD
Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
hpx  Helicobacter pylori 83
Pathway
hpx00540  Lipopolysaccharide biosynthesis
hpx01100  Metabolic pathways
Module
hpx_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:hpx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HMPREF0462_0549 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpx01005]
    HMPREF0462_0549 (rfaD)
Enzymes [BR:hpx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     HMPREF0462_0549 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:hpx01005]
 Unusual sugar
  HMPREF0462_0549 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_4 KR
Motif
Other DBs
NCBI-ProteinID: AEE70154
UniProt: F4D579
Structure
PDB: 

Position
531962..532954
Genome map
AA seq 330 aa AA seqDB search
MRYIDDELENQTILITGGAGFVGSNLAFYFQENHPKAKVIILDKFRSNTLFSNKRPSSLG
HFKNLIGFKGEVVIADINNPLDLRRLEKLHFDYLFHQAAVSDTTMLDQELVMKTNYQAFL
NLLEIARSKKAKVIYASSAGVYGNTKAPNVVGKNEGPENVYGFSKLCMDEFVLSHSNDNI
QVGLRYFNVYGPREFYKEKTASMVLQLALGAMAFKEVKLFEFGEQLRDFVYIEDVIQANV
KAMKAQKSGVYNVGYSQARSYNEIVSILKEHLGDFKVTYIKNPYAFFQNHTQAHIEPTIL
DLDYTPLYDLGSGIKDYLPHIHAIFKEQCA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatattgatgatgaattagaaaatcaaacgattttaatcaccggtggggctggc
tttgtgggcagtaatctggccttttattttcaagagaaccaccctaaagctaaagtaatc
attttggataagtttcgcagtaacacgctcttcagtaataagcgccccagttccctaggg
cattttaagaatttaatcggttttaagggtgaggtggttatagctgatattaataacccc
ttagatttaaggcgtttagaaaaattgcattttgattatttgttccaccaagccgctgtc
tctgatacgaccatgctggatcaagaattagtgatgaaaaccaactaccaggctttttta
aaccttttagaaatcgctcgctcaaaaaaagctaaagtgatttacgcttcttcagcaggc
gtttatggcaacaccaaagcccccaatgtggtaggcaaaaacgaaggccctgaaaatgtt
tatggcttttccaagctttgcatggacgaatttgtcctctcccattcaaatgacaacatt
caagtgggcttaaggtattttaatgtctatgggcctagggaattttataaagaaaaaacc
gcttctatggttttgcaactcgccttaggcgcaatggcgtttaaggaagtcaaacttttt
gaatttggcgagcaattaagggattttgtctatattgaagatgtgatccaagcgaatgtg
aaagcgatgaaggctcaaaaaagtggggtttataatgtgggttattcccaagccagaagt
tataatgaaatagttagcattttaaaagagcatttaggggattttaaagtaacttatatc
aaaaacccttatgctttcttccaaaatcacacccaagcgcatattgaacctactattttg
gatttagactacacccctttatacgatttaggaagcggcattaaagattatttgccccat
atccatgcgatttttaaagaacagtgcgcatga

DBGET integrated database retrieval system