KEGG   Helicobacter pylori 83: HMPREF0462_0751Help
Entry
HMPREF0462_0751   CDS       T01915                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpx  Helicobacter pylori 83
Pathway
hpx00071  Fatty acid degradation
hpx00072  Synthesis and degradation of ketone bodies
hpx00280  Valine, leucine and isoleucine degradation
hpx00310  Lysine degradation
hpx00362  Benzoate degradation
hpx00380  Tryptophan metabolism
hpx00620  Pyruvate metabolism
hpx00630  Glyoxylate and dicarboxylate metabolism
hpx00640  Propanoate metabolism
hpx00650  Butanoate metabolism
hpx00900  Terpenoid backbone biosynthesis
hpx01100  Metabolic pathways
hpx01110  Biosynthesis of secondary metabolites
hpx01120  Microbial metabolism in diverse environments
hpx01130  Biosynthesis of antibiotics
hpx01200  Carbon metabolism
hpx01212  Fatty acid metabolism
hpx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HMPREF0462_0751
   00630 Glyoxylate and dicarboxylate metabolism
    HMPREF0462_0751
   00640 Propanoate metabolism
    HMPREF0462_0751
   00650 Butanoate metabolism
    HMPREF0462_0751
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HMPREF0462_0751
   00072 Synthesis and degradation of ketone bodies
    HMPREF0462_0751
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HMPREF0462_0751
   00310 Lysine degradation
    HMPREF0462_0751
   00380 Tryptophan metabolism
    HMPREF0462_0751
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF0462_0751
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HMPREF0462_0751
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HMPREF0462_0751
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpx04147]
    HMPREF0462_0751
Enzymes [BR:hpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HMPREF0462_0751
Exosome [BR:hpx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF0462_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEE70356
UniProt: F4D5T1
Position
730802..731977
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAIGSFLGSLKSVGAREMGTVVLKDALNASGLEPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDKNAFSVNMVCGSSMKAIQLAHDSIMLGHDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQLKARVAINAGKFQEEITPIEIANKKGVAVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAQKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIRNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELEINPSIVNVNGGAIAIGHPIGASGARILVTL
LHEMKKSAYGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctatagggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggcactgttgtgcttaaggacgctttgaatgcg
agcggccttgagcctagcgatgtggattctgtcattttaggcaatgttttaggtgctggt
ttgggtcaaaatatcgccagacagatccaattagacgctggtatccctaatgacaaaaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcacatgac
agcatcatgcttgggcacgatgaggtggtggtgtgcggtggcgtggaaaacatgagtgca
gcgccttatttgtcgtttgacatgcgagacgggaaaagaatggggaatgcgaacatgata
gactccatgatccatgacggattatgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgctttcgcgctc
caatcgcaactcaaagcaagagttgccattaatgcagggaaattccaagaagaaatcacg
cccattgaaatagcgaataaaaaaggcgtggctgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagtgct
caaaaagcgcaaaaattggggttaaaaacaatggcaactatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattagaaacaatcttaaa
aatgtcaaaatgaatctcaatgacatcaatctttttgaactcaatgaagccttcgccgcg
caaagcatagccgtgttaaaagagcttgaaataaaccctagtattgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggcgcaagcggcgctaggatcttagtaacttta
ttgcatgaaatgaaaaaaagcgcttatggcgtgggttgtgcgtcattgtgtgtgggcggc
ggacaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system