KEGG   Helicobacter pylori 83: HMPREF0462_1122Help
Entry
HMPREF0462_1122   CDS       T01915                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hpx  Helicobacter pylori 83
Pathway
hpx00010  Glycolysis / Gluconeogenesis
hpx00020  Citrate cycle (TCA cycle)
hpx00620  Pyruvate metabolism
hpx00640  Propanoate metabolism
hpx00650  Butanoate metabolism
hpx00680  Methane metabolism
hpx01100  Metabolic pathways
hpx01120  Microbial metabolism in diverse environments
hpx01130  Biosynthesis of antibiotics
hpx01200  Carbon metabolism
Module
hpx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0462_1122 (porD)
   00020 Citrate cycle (TCA cycle)
    HMPREF0462_1122 (porD)
   00620 Pyruvate metabolism
    HMPREF0462_1122 (porD)
   00640 Propanoate metabolism
    HMPREF0462_1122 (porD)
   00650 Butanoate metabolism
    HMPREF0462_1122 (porD)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0462_1122 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HMPREF0462_1122 (porD)
Enzymes [BR:hpx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HMPREF0462_1122 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_2 Fer4_7 Fer4_9 Fer4_17 Fer4_16 Fer4_15 Fer4_13 Fer4_4 Fer4_8 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AEE70726
UniProt: F4D292
Position
1126737..1127129
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIDPTTALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtactcttcccttttgaaaaaaacgca
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagctacttcacc
acttcagtggctcattggcgcgtggctaagcctgtgcataacaataacatttgcatcaat
tgctttaattgttgggtttattgcccagacgctgctattctttcaagagagggcaagtta
aaaggcgtggattattctcattgtaaaggctgtggcgtgtgcgtggatgtctgccccacc
aaccccaaatcgctatggatgtttgaagaacaaattgatcctactaccgccctcactcaa
tggccgcaaaaacaagaaaagaaaaaatcgtaa

DBGET integrated database retrieval system