KEGG   Helicobacter pylori 83: HMPREF0462_1238Help
Entry
HMPREF0462_1238   CDS       T01915                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hpx  Helicobacter pylori 83
Pathway
hpx00860  Porphyrin and chlorophyll metabolism
hpx01100  Metabolic pathways
hpx01110  Biosynthesis of secondary metabolites
hpx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HMPREF0462_1238 (hemD)
Enzymes [BR:hpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HMPREF0462_1238 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Peptidase_S41
Motif
Other DBs
NCBI-ProteinID: AEE70842
UniProt: F4D2S6
Position
1253240..1253920
Genome map
AA seq 226 aa AA seqDB search
MREIVWVHSQRIAPYKTLILNEFSYYPLKLDPTPFNALIFTSKNAVFSLLETLKNSPKLQ
ILQNIPAYALSEPTAKTLQDHHFKVAFIGEKAHGKEFVQEIIPLLEKKSVLYLRAKEIAS
SLDAILLEHGIDFKQAVVYENKLKHLTLSEQNALKPKEKSILIFTAISHAKAFLHYFEFL
ENYTAISIGNTTALYLQEKGIQSYTAKKPSLEACLELALSLRVKEC
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagggagattgtatgggtgcattctcaaagaatcgccccttataagactctcatttta
aatgaattttcctactatcccttaaaattagatccaaccccttttaacgcccttattttc
acttctaaaaatgcggtgttttccttgctagaaactctaaaaaacagccccaaactccaa
attttacaaaacattcctgcttacgctttgagcgaacccaccgcaaaaaccttacaagat
caccattttaaagtcgcctttataggggaaaaagcccatggtaaagagtttgttcaagaa
atcattcctttattggaaaaaaaaagcgttttgtatctcagggcaaaagaaattgcctct
tctttagacgccattcttttagagcatggcattgatttcaagcaagccgttgtttatgaa
aacaagctcaaacatttaaccttaagcgaacaaaacgccctaaaacccaaagaaaagagt
attcttatttttaccgctataagccatgcaaaagcctttttacactattttgaattttta
gaaaattacaccgctataagcattggcaacacgaccgctctttatttgcaagagaaaggc
attcaaagttataccgccaaaaagccctccttagaagcgtgtttagagctggctttgagt
ttgagggttaaggaatgttaa

DBGET integrated database retrieval system