KEGG   Helicobacter pylori 26695: HP0522
Entry
HP0522            CDS       T00008                                 

Definition
(RefSeq) cag pathogenicity island protein cag3
  KO
K12088  cag pathogenicity island protein 3
Organism
hpy  Helicobacter pylori 26695
Pathway
hpy05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hpy_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpy00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HP0522
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpy02044]
    HP0522
Secretion system [BR:hpy02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HP0522
SSDB
Other DBs
NCBI-GeneID: 899037
NCBI-ProteinID: NP_207318
UniProt: O25258
Position
548134..549579
AA seq 481 aa
MFRKLATAVSLIGLLTSNTLYAKEISEADKVIKATKETKETKKEAKRLKKEAKQRQQIPD
HKKPQYVSVDDTKTQALFDIYDTLNVNDKSFGDWFGNSALKDKTYLYAMDLLDYNNYLSI
ENPIIKTRAMGTYADLIIITGSLEQVNGYYNILKALNKRNAKFVLKINENMPYAQATFLR
VPKRSDPNAHTLDKGASIDENKLFEQQKKMYFNYANDVICRPDDEVCSPLRDEMVAMPTS
DSVTQKPNIIAPYSLYRLKETNNANEAQPSPYATQTAPENSKEKLIEELIANSQLVANEE
EREKKLLAEKEKQEAELAKYKLKDLENQKKLKALEAELKKKNAKKPRVVEVPVSPQTSNS
DETMRVVKEKENYNGLLVDKETTIKRSYEGTLISENSYSKKTPLNPNDLRSLEEEIKSYY
IKSNGLCYTNGINLYVKIKNDPYKEGMLCGYESVQNLLSPLKDKLKYDKQKLQKALLKDS
K
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgtttagaaaactagcaaccgctgtatcgctcataggcttactaacctctaacactctt
tatgctaaagaaataagtgaagccgataaggtcattaaggccactaaagaaactaaagag
accaagaaagaagctaaacgactcaaaaaagaagctaaacagcgccaacagatccctgat
cataagaaacctcaatatgtctctgttgatgacacaaaaactcaagcgctgtttgatata
tacgacaccttgaatgtgaatgacaaaagctttggggattggtttggtaatagcgctttg
aaagacaaaacctatctctacgctatggatctattggattacaacaactatttatccata
gaaaaccccattatcaaaacaagagcaatgggaacttatgcggatttgattatcatcaca
ggctcattagagcaagtcaatgggtattacaacattctaaaagcgctcaacaaacgcaac
gctaagtttgtgttaaaaatcaatgagaacatgccttatgcccaagcgacttttttaaga
gtgccaaaaagaagcgatcctaatgcccacacgcttgataagggagcgtcaattgatgag
aataagctttttgaacaacaaaagaaaatgtatttcaattacgctaacgatgtgatctgc
agacccgatgatgaagtgtgttcgcccctaagagatgagatggtagctatgcccactagc
gatagcgttactcaaaaacccaatatcattgctccttatagcttgtatagactaaaagag
acaaataacgccaatgaggcccaaccatcaccttatgccactcaaaccgctcccgaaaac
agcaaagagaagctcatagaagagctaatcgctaactcccaactcgtagccaatgaagaa
gagagggaaaagaaactcttagcagaaaaagaaaaacaagaggctgaattggctaaatat
aagctcaaagacttagaaaatcaaaagaaactaaaagctttagaagcagagttgaaaaag
aaaaacgctaagaaacctagagtagtggaagtgcctgtttctcctcaaacaagtaattct
gatgaaacaatgagagttgtcaaagaaaaagagaactataatgggttattagtggataag
gagaccacgatcaaaagaagctatgaggggactttgatcagtgaaaattcttacagcaaa
aaaacacctctcaaccctaatgacttgaggagcttagaagaagaaattaagagctactat
atcaagtctaatggcttgtgttatactaatggcattaacctctatgtaaaaatcaaaaac
gacccctataaagagggaatgctgtgtggttatgagagcgttcaaaatctgctctcacct
ctaaaggacaagctcaaatacgacaaacaaaagttacaaaaagcgttactgaaagattca
aagtaa

DBGET integrated database retrieval system