KEGG   Helicobacter pylori 26695: HP0523
Entry
HP0523            CDS       T00008                                 

Definition
(RefSeq) cag pathogenicity island protein cag4
  KO
K12089  cag pathogenicity island protein 4
Organism
hpy  Helicobacter pylori 26695
Pathway
hpy05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hpy_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpy00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HP0523
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpy02044]
    HP0523
Secretion system [BR:hpy02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HP0523
SSDB
Motif
Pfam: SLT CathepsinC_exc
Other DBs
NCBI-GeneID: 900205
NCBI-ProteinID: NP_207319
UniProt: O25259
Position
549589..550098
AA seq 169 aa
MFEKWIGLTLLLNSLAYPCQKVTISFKQYENLLHIHQKGCDNEVMCRTLISIALLESSLG
LNNRREKSLKDTSYSMFHITLNTAKKFYPTYSKTLLKFKLLNDVGFAIQLAKQILKENFD
YYKQKHPNKSVYQLVEMAIGAYNGGMKHNPNGAYVKKFRCIYSQVRYNE
NT seq 510 nt   +upstreamnt  +downstreamnt
ttgttcgagaaatggattggtctgactttgcttcttaattccttagcctatccatgccaa
aaggtaaccattagtttcaagcagtatgaaaatcttctccatatccatcaaaaaggttgc
gacaatgaagtgatgtgcagaacgctcatctctatcgctttgttagaaagctctctaggg
ttgaacaacaggcgagaaaaatcccttaaagacacttcttattccatgtttcatatcacc
ctaaacaccgctaaaaaattctaccctacctactctaaaacgctcctcaaattcaaattg
ctaaacgatgtgggttttgcgatccaattagccaaacaaattttaaaagaaaattttgat
tattacaaacaaaaacaccccaacaaaagcgtgtatcaattagtagaaatggcaataggc
gcttacaatgggggaatgaaacacaaccctaatggcgcttacgtgaaaaaattccgttgc
atttattctcaagtgcgatataacgagtag

DBGET integrated database retrieval system