KEGG   Helicobacter pylori 26695: HP0531
Entry
HP0531            CDS       T00008                                 

Definition
(RefSeq) cag pathogenicity island protein cag11
  KO
K12096  cag pathogenicity island protein 11
Organism
hpy  Helicobacter pylori 26695
Pathway
hpy05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hpy_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpy00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HP0531
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpy02044]
    HP0531
Secretion system [BR:hpy02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HP0531
SSDB
Motif
Pfam: tRNA-synt_1f
Other DBs
NCBI-GeneID: 900046
NCBI-ProteinID: NP_207327
UniProt: O25266
Position
564381..565037
AA seq 218 aa
MNDTTEHHGPNPLNAPPPSNSQSNDLLNLLDSLYPKGSLGEQRFHEALKNQEELKNILIE
IEKLPQEKRYELLMQIGQAKQRIMEAYAHSFLGYIGGLEHLLGLCMGGIFVLFAIYFVFL
RTSKNMELVESLKTKLKLQYFYYAFGVGAVLFFGLETIRSIYELYILGIGSTNDKVLFVL
KNICFIGMGYLIYKVIKVIGIKNFINGLFTSKKQGGAE
NT seq 657 nt   +upstreamnt  +downstreamnt
atgaacgatacaacagagcatcatggacctaatccgctaaacgctccaccacctagcaac
tcacagagcaatgatcttttaaatttgctagactcattatatcctaaagggagtttaggg
gagcaaagatttcacgaagctttaaagaatcaagaagagttgaaaaatatcctaatagaa
atagaaaagctaccgcaagaaaaaaggtatgaacttctgatgcagataggacaagccaag
caaagaataatggaagcatatgctcattcattcttaggatatatagggggactagagcat
ctgttaggattgtgtatgggtgggatatttgttttgtttgcaatctattttgtattttta
agaactagcaaaaacatggagctagtggaaagtctaaaaacaaaactaaaacttcagtat
ttttactatgcctttggtgtgggtgcggttttgttttttggattagaaacaattagatct
atttatgaactatatatcttaggaattggtagcactaacgacaaggtgctctttgttttg
aaaaacatttgcttcataggtatgggctatttgatttataaagttattaaggttattggt
ataaaaaattttatcaatggtcttttcacttcaaagaaacaaggcggtgcagaatga

DBGET integrated database retrieval system