KEGG   Helicobacter pylori 26695: HP0537Help
Entry
HP0537            CDS       T00008                                 

Definition
(RefSeq) cag pathogenicity island protein cag16
  KO
K12101  cag pathogenicity island protein 16
Organism
hpy  Helicobacter pylori 26695
Pathway
hpy05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hpy_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpy00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HP0537
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpy02044]
    HP0537
Secretion system [BR:hpy02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HP0537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD_assoc
Motif
Other DBs
NCBI-GeneID: 900246
NCBI-ProteinID: NP_207333
UniProt: O25270
Position
568723..569853
Genome map
AA seq 376 aa AA seqDB search
MLAKIVFSSLVAFGVLSANVEQFGSFFNEIKKEQEEVAAKEDALKARKKLLNNTHDFLED
LIFRKQKIKELMDHRAKVLSDLENKYKKEKEALEKETRGKILTAKSKAYGDLEQALKDNP
LYRKLLPNPYAYVLNQETFTKEDRERLSYYYPQVKTSSIFKKTTATTKDKAQALLQMGVF
SLDEEQNKKASRLALSYKQAIEEYSNNVSNLLSRKELDNIDYYLQLERNKFDSKAKDIAQ
KATNTLIFNSERLAFSMAIDKINEKYLRGYEAFSNLLKNVKDDVELNTLTKNFTNQKLSF
AQKQKLCLLVLDSFNFDTQSKKSILKKTNEYNIFVDSDPMMSDKTTMQKEHYKIFNFFKT
VVSAYRNNVAKNNPFE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcaaaaatcgtttttagctcattggttgcgtttggagttttgtcggctaatgtg
gagcagtttggttcatttttcaacgagataaaaaaagaacaagaagaagtggctgcaaaa
gaagacgctcttaaggctcgcaagaagctcttaaacaatacgcatgatttcttagaagac
ttgatttttagaaaacaaaaaatcaaagagcttatggatcatagagctaaagttctttca
gacttagaaaacaaatacaaaaaagaaaaagaggctctagagaaagagacaagaggtaaa
atccttactgctaagtcaaaggcttatggggatttggagcaagccttaaaagataaccct
ctctataggaaacttcttcctaacccttatgcctatgttttaaaccaagaaacattcacc
aaagaagatagggagcgtttgagttattactacccccaggtgaaaacgagcagtattttt
aaaaaaaccaccgctaccactaaagataaggctcaggctttgcttcaaatgggtgtgttt
tctttagatgaagaacaaaacaaaaaagcgagccgattagctttatcttacaagcaagcg
attgaagaatattccaataacgtttctaatttattgagcagaaaagaattggataatata
gattattacttacagcttgaaagaaacaagtttgactccaaagcaaaagatattgctcaa
aaggctactaacacgcttatttttaattcggaacgcttggcgtttagcatggcgattgat
aagatcaatgagaaatacttaaggggctatgaggctttttctaacttgttgaaaaatgtc
aaagatgatgtggaattgaatactctgactaaaaattttaccaatcaaaaattgagtttc
gcacaaaaacaaaaattgtgtttgttggttttagacagcttcaattttgatacccaatcc
aaaaaatctatattaaaaaagactaatgaatacaatattttcgtagatagcgatcctatg
atgagcgacaaaaccactatgcaaaaagaacactacaagatatttaatttcttcaaaaca
gtggtttctgcataccgaaacaatgttgccaagaataatccctttgaatag

DBGET integrated database retrieval system