KEGG   Helicobacter pylori 26695: HP0546
Entry
HP0546            CDS       T00008                                 

Definition
(RefSeq) cag pathogenicity island protein cag25
  KO
K12110  cag pathogenicity island protein 25
Organism
hpy  Helicobacter pylori 26695
Pathway
hpy05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hpy_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpy00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HP0546
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpy02044]
    HP0546
Secretion system [BR:hpy02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HP0546
SSDB
Motif
Pfam: T4SS_CagC
Other DBs
NCBI-GeneID: 900038
NCBI-ProteinID: NP_207342
UniProt: O25278
Position
complement(578740..579087)
AA seq 115 aa
MKFFTRITDSYKKVVVTLGLVVTTNPLMAVTSPAEGVTETKTLVIQIISVLAIVGGCALG
VKGIADIWKISDDIKRGQATVFAYAQPIAMLAVAGGIIYLSTKFGFNIGESGGAS
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaaattttttacaagaatcactgacagctacaagaaagttgtagtaactttagggcta
gtggtaacaaccaatcctttaatggcggtcaccagtcctgcagaaggcgttactgagact
aaaactttggttattcagatcatttctgttctagcgatcgtagggggttgcgctttaggg
gtcaaaggcatagcggatatttggaaaatctctgatgatatcaaaagaggtcaggcgact
gtttttgcttacgcgcaacccatagctatgttagcggtggcaggcggtattatctatttg
agcactaagtttggcttcaatattggcgagagcggaggagctagctaa

DBGET integrated database retrieval system