KEGG   Helicobacter pylori 26695: HP0662Help
Entry
HP0662            CDS       T00008                                 

Gene name
rnc
Definition
(RefSeq) ribonuclease III
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
hpy  Helicobacter pylori 26695
Brite
KEGG Orthology (KO) [BR:hpy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hpy03019]
    HP0662 (rnc)
   03009 Ribosome biogenesis [BR:hpy03009]
    HP0662 (rnc)
   03036 Chromosome and associated proteins [BR:hpy03036]
    HP0662 (rnc)
Enzymes [BR:hpy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     HP0662 (rnc)
Messenger RNA biogenesis [BR:hpy03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     HP0662 (rnc)
Ribosome biogenesis [BR:hpy03009]
 Eukaryotic Type
  90S particles
   RNase
    HP0662 (rnc)
 Prokaryotic Type
  rRNA processing factors
   HP0662 (rnc)
Chromosome and associated proteins [BR:hpy03036]
 Eukaryotic Type
  Gene silencing
   microRNA pathway
    Microprocessor complex
     HP0662 (rnc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm DND1_DSRM
Motif
Other DBs
NCBI-GeneID: 899029
NCBI-ProteinID: NP_207456
UniProt: P56118
Position
709973..710695
Genome map
AA seq 240 aa AA seqDB search
MMKNKRSQNSPYITPNSSYTTLEKALGYSFKDKRLLEQALTHKSCKLALNNERLEFLGDA
VLGLVIGELLYHKFYQYDEGKLSKLRASIVSAHGFTKLAKAIALQDYLRVSSSEEISNGR
EKPSILSSAFEALMAGVYLEAGLAKVQKIMQNLLNRAYKRLDLEHLFMDYKTALQELTQA
QFCVIPTYQLLKEKGPDHHKEFEMALYIQDKMYATAKGKSKKEAEQQCAYQALQKLKEAK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaacaaacgctctcaaaacagcccttacataacgcctaatagctcttataca
acgctagaaaaagctttggggtattcttttaaagacaagcgtttattggagcaagcctta
acgcacaaatcatgcaagctcgctttaaacaatgagcgcttggaatttttaggcgatgcg
gtgttgggtttggtgataggggagttgctataccataaattctaccaatacgatgaggga
aaactctctaaattaagggcttctattgtgagcgcgcatggttttactaaattagcgaaa
gcgatcgctttacaagattatttgcgcgtttcttcttctgaagaaatttctaacgggaga
gaaaaaccctctattttatcaagcgcttttgaggctttaatggctggggtgtatttagaa
gcggggttagctaaggtgcaaaaaatcatgcaaaatttactcaatcgcgcttacaagcgt
ttggatttagagcatttgtttatggactataaaaccgctttacaggaattaacccaagcg
caattttgcgtgatccccacttaccaattgctcaaagaaaaggggccagaccatcataaa
gaatttgaaatggctctatacattcaagataaaatgtatgcgaccgctaaaggcaaaagc
aaaaaagaagccgaacagcaatgcgcttatcaagcgcttcaaaaactgaaggaagccaaa
tga

DBGET integrated database retrieval system