KEGG   Helicobacter pylori 26695: HP0690Help
Entry
HP0690            CDS       T00008                                 

Definition
(RefSeq) acetyl CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpy  Helicobacter pylori 26695
Pathway
hpy00071  Fatty acid degradation
hpy00072  Synthesis and degradation of ketone bodies
hpy00280  Valine, leucine and isoleucine degradation
hpy00310  Lysine degradation
hpy00362  Benzoate degradation
hpy00380  Tryptophan metabolism
hpy00620  Pyruvate metabolism
hpy00630  Glyoxylate and dicarboxylate metabolism
hpy00640  Propanoate metabolism
hpy00650  Butanoate metabolism
hpy00900  Terpenoid backbone biosynthesis
hpy01100  Metabolic pathways
hpy01110  Biosynthesis of secondary metabolites
hpy01120  Microbial metabolism in diverse environments
hpy01130  Biosynthesis of antibiotics
hpy01200  Carbon metabolism
hpy01212  Fatty acid metabolism
hpy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HP0690
   00630 Glyoxylate and dicarboxylate metabolism
    HP0690
   00640 Propanoate metabolism
    HP0690
   00650 Butanoate metabolism
    HP0690
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HP0690
   00072 Synthesis and degradation of ketone bodies
    HP0690
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HP0690
   00310 Lysine degradation
    HP0690
   00380 Tryptophan metabolism
    HP0690
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HP0690
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HP0690
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HP0690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpy04147]
    HP0690
Enzymes [BR:hpy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HP0690
Exosome [BR:hpy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HP0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 899312
NCBI-ProteinID: NP_207484
UniProt: O25399
Position
740559..741734
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGVSVLKDALNASGLKPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDKNAFSVNMVCGSSMKAIQLAHDSIMLGRDEMVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNNYHMGITADNVAQAYHISREDQDNFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSTKKAQTLGLKAMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDIHLFELNEAFAAQSLAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctgtagggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggtgttagcgtgcttaaagacgctttgaatgcg
agcggccttaagcctagcgatgtggattctgtcattttaggcaatgttttaggcgctggt
ttgggtcaaaatatcgccaggcagatccaactagacgccggcatccctaatgacaaaaac
gcttttagcgtcaatatggtttgcggatcgtctatgaaagctatccagttagcgcatgac
agcatcatgcttgggcgcgatgagatggtggtgtgcggtggcgtggagaacatgagcgca
gcaccctatttgtcgtttgacatgcgagatgggaaaagaatggggaatgcgaacatgata
gattccatgatacatgatggattgtgggatgcgttcaataattaccacatggggatcacc
gctgataatgtcgctcaagcataccacataagccgagaagatcaagataatttcgcgctc
cagtcgcaactcaaagcaagagccgccattaatgcagggaaattccaagaagaaatcacg
cctattgaaatagcgaataaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcgggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcact
aaaaaagcgcaaacattggggttaaaagccatggcgactatcaaggggtttggtttgggt
ggttgcagtccggatataatgggtatatgccctagcatcgcgattaaaaacaaccttaaa
aatgtcaaaatgaatctcaatgacatccatctttttgaactcaatgaagcctttgccgcg
caaagcctagccgtgttaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggcgcgatagcgattggccaccctattggcgcgagcggtgctaggatattggtaacttta
ttgcatgaaatgaaaaggagcgggcatggcgtgggttgtgcgtcattgtgtgtgggcggc
gggcaaggtctttctgtggtagttgaacaaaaataa

DBGET integrated database retrieval system