KEGG   Helicobacter pylori 26695: HP0791Help
Entry
HP0791            CDS       T00008                                 

Definition
(RefSeq) cadmium, zinc and cobalt-transporting ATPase
  KO
K01534  Cd2+/Zn2+-exporting ATPase [EC:3.6.3.3 7.2.2.12]
Organism
hpy  Helicobacter pylori 26695
Brite
KEGG Orthology (KO) [BR:hpy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HP0791
Enzymes [BR:hpy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.3  Cd2+-exporting ATPase
     HP0791
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.12  P-type Zn2+ transporter
     HP0791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase Hydrolase HMA Hydrolase_3 DNA_ligase_ZBD
Motif
Other DBs
NCBI-GeneID: 899347
NCBI-ProteinID: NP_207584
UniProt: Q59465
Position
complement(846877..848937)
Genome map
AA seq 686 aa AA seqDB search
MQEYHIHNLDCPDCASKLERDLNELDYVKKAQINFSTSKLFLDTSDFEKVKAFIKQNEPH
LSLSFKEATEKPLSFTPLIITIMVFLGAILILHLNPSPLIEKAMFFVLALVYLVSGKDVI
LGAFRGLRKGQFFDENALMLIATIAAFFVGAYEESVSIMVFYSAGEFLQKLAVSRSKKSL
KALVDVAPNLAYLKKGDELVSVAPEDLRVNDIVVVKVGEKVPVDGVVVKGESLLDERALS
GESMPVNVSENSKVLGGSLNLKAVLEIQVEKMYKDSSIAKVVDLVQQATNEKSETEKFIT
KFSRYYTPSVLFIALMIAVLPPLFSMGSFDEWIYRGLVALMVSCPCALVISVPLGYFGGV
GAASRKGILMKGVHVLEVLTQAKSIAFDKTGTLTKGVFKVTDIVPQNGHSKEEVLHYASC
SQLLSTHPIALSIQKACEEMLKDDKHQHDIKNYEEVSGMGVKAQCHTDLIIAGNEKMLDQ
FHIAHSPSKENGTIVHVAFNQTYVGYIVISDEIKDDAIECLRDLKVQGIENFCILSGDRK
SATESIAQTLGCEYHASLLPEEKTSVFKTFKERYKAPAIFVGDGINDAPTLASADVGIGM
GKGSELSKQSADIVITNDSLNSLVKVLAIAKKTKSIIWQNILFALGIKAVFIVLGLMGVA
SLWEAVFGDVGVTLLALANSMRAMRA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaataccacattcataatttggattgccctgattgtgcgtctaaattagaaagg
gatttaaacgaattagactatgtgaaaaaagctcaaatcaatttcagcaccagtaagttg
tttttggacacgagcgattttgaaaaagttaaggctttcatcaagcagaatgaaccgcat
ttgagcctgtcttttaaagaggctacagaaaagcccttgagttttacgccactcatcatt
acgatcatggtttttttgggcgcgattttaatcttgcacctaaaccctagccctttgatt
gaaaaggctatgtttttcgtgttggctttagtgtatctagtgagcggtaaagatgtgatt
ttaggggcgtttcgtgggcttaggaaagggcaattttttgatgaaaacgctttgatgctc
attgcgactattgcggctttttttgtgggggcttatgaagagagcgtgtctattatggtg
ttttattcagcgggcgaatttttgcaaaaactcgctgtctctcgctctaaaaaatccctt
aaggctttagtggatgtcgctcctaatttggcttatttgaaaaagggcgatgaattagtg
agcgttgcgcctgaagatttaagagtcaatgatattgtggtggtgaaagttggcgaaaaa
gtgcctgtggatggcgtggtagttaagggcgaaagcttgctagatgaaagggcgttgagt
ggggagtctatgcctgttaatgtcagcgaaaattctaaagttttaggggggagcttgaat
ttaaaagcggtccttgaaattcaagtggaaaaaatgtataaagattcttctatcgctaaa
gtggtggatttggtccaacaagccacgaatgaaaagagcgaaaccgagaaatttatcact
aaattttcacgctactacaccccaagcgttttattcattgctttaatgatcgctgtatta
ccgcccttgttttctatggggagctttgatgagtggatttatagggggcttgtggcttta
atggtgagctgcccttgcgcgttagtgatttctgtgcctttagggtattttgggggcgtg
ggagcagcaagcagaaagggcattttaatgaaaggcgtgcatgttttagaggtgcttacc
caagctaaaagcatcgcttttgataaaaccggcactttgactaaaggcgtttttaaagta
acggatattgtgccgcaaaatgggcattctaaagaagaagttttgcattacgcttcttgt
tcgcagctcttatccacgcaccctatcgctttatccattcaaaaagcatgcgaagaaatg
ttaaaggacgataagcaccaacatgacattaaaaattacgaagaagtgagcgggatgggg
gttaaagcgcaatgccatacggatttaatcatcgcagggaatgaaaaaatgctcgatcaa
ttccatatcgcgcacagcccttccaaagaaaacggcacgatcgtgcatgtggctttcaat
caaacttatgtgggctatatcgtcattagcgatgagattaaagatgacgccatagagtgc
ttaagggatttaaaagtgcaagggatagaaaatttttgcattttgagcggggacagaaag
agcgcgactgagagcatcgctcaaaccctaggctgtgaataccatgcgagcttgttgcct
gaagaaaaaacgagcgtgtttaaaacctttaaagaacgctataaagctccggcgattttt
gtaggcgatggcatcaatgacgctccgactctagcgagtgctgatgtggggattggcatg
gggaaaggatcagaattgagcaagcaaagcgcagacattgtgatcaccaatgactcttta
aattcgttagtgaaagttttagcgatcgctaaaaaaactaaaagcattatttggcaaaat
atcttgttcgctttagggattaaagccgtttttatcgtgctagggcttatgggggtagcg
agcttgtgggaagcggtctttggcgatgtgggggttacgcttttagccttagccaattcc
atgcgcgcgatgagagcttaa

DBGET integrated database retrieval system