KEGG   Helicobacter pylori 26695: HP0875Help
Entry
HP0875            CDS       T00008                                 

Definition
(RefSeq) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
hpy  Helicobacter pylori 26695
Pathway
hpy00380  Tryptophan metabolism
hpy00630  Glyoxylate and dicarboxylate metabolism
hpy01110  Biosynthesis of secondary metabolites
hpy01130  Biosynthesis of antibiotics
hpy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HP0875
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    HP0875
Enzymes [BR:hpy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     HP0875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-GeneID: 899404
NCBI-ProteinID: NP_207669
UniProt: P77872
Structure
PDB: 

Position
complement(925571..927088)
Genome map
AA seq 505 aa AA seqDB search
MVNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLEKLAAFDRERIPERVVHAKGS
GAYGTFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGERGSADAVRDPRGFAMKYYTE
EGNWDLVGNNTPVFFIRDAIKFPDFIHTQKRDPQTNLPNHDMVWDFWSNVPESLYQVTWV
MSDRGIPKSFRHMDGFGSHTFSLINAKGERFWVKFHFHTMQGVKHLTNEEAAEVRKYDPD
SNQRDLFNAIARGDFPKWKLSIQVMPEEDAKKYRFHPFDVTKIWYLQDYPLMEVGIVELN
KNPENYFAEVEQAAFSPANVVPGIGYSPDRMLQGRLFSYGDTHRYRLGVNYPQIPVNKPR
CPFHSSSRDGYMQNGYYGSLQNYTPSSLPGYKEDKSARDPKFNLAHIEKEFEVWNWDYRA
DDSDYYTQPGDYYRSLPADEKERLHDTIGESLAHVTHKEIVDKQLEHFKKADPKYAEGVK
KALEKHQKMMKDMHGKDMHHTKKKK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggttaataaagatgtgaaacaaaccactgcttttggcgctcccgtttgggatgacaac
aatgtgattacggccggccctagaggtcctgttttattacaaagcacttggtttttggaa
aagttagcggcgtttgacagagaaagaatccctgaaagggtggtgcatgctaaaggaagc
ggagcttatggcactttcactgtgactaaagacatcactaaatacactaaagcgaaaatt
ttctctaaagtgggcaaaaaaaccgaatgcttcttcagattttctactgtggctggtgaa
agaggcagtgcggatgcggtgagagaccctagaggttttgcgatgaagtattacactgaa
gaaggtaactgggatttagtggggaacaacacgcctgttttctttatccgtgatgcgatc
aaattccctgatttcatccacactcaaaaacgagatcctcaaaccaatttgcctaaccat
gacatggtatgggatttttggagtaatgttcctgaaagcttataccaagtaacatgggtt
atgagcgataggggtattcctaaatctttccgccacatggatggttttggcagccacact
ttcagtcttatcaacgcgaaaggcgaacgcttttgggtgaaattccactttcacaccatg
caaggcgttaagcatttgactaacgaagaagccgcagaagttaggaagtatgatccggat
tccaatcaaagggatttattcaatgcgatcgctagaggggatttcccaaaatggaaatta
agcattcaagtgatgccagaagaagatgctaagaagtatcgattccatccgtttgatgta
actaaaatttggtatctccaagattatccattgatggaagtgggcattgtggagttgaat
aaaaatcctgaaaactatttcgcagaagtggaacaagcggcattcagtccggctaatgtc
gttcctggaattggctatagccctgataggatgttacaagggcgcttgttctcttatgga
gacacacaccgctaccgcttaggcgttaattatcctcaaataccggttaataaaccaaga
tgcccattccactcttctagcagagatggttacatgcaaaacggatactacggctcttta
caaaactatacgcctagctcattgcctggctataaagaagataagagcgcgagagatcct
aagttcaacttagctcatattgagaaagagtttgaagtgtggaattgggattacagagct
gatgatagcgattactacacccaaccaggtgattactaccgctcattgccagctgatgaa
aaagaaaggttgcatgacactattggagagtctttagctcatgttacccataaggaaatt
gtggataaacaattggagcatttcaagaaagctgaccccaaatacgctgagggagttaaa
aaagctcttgaaaaacaccaaaaaatgatgaaagacatgcatggaaaagacatgcaccac
acaaaaaagaaaaagtaa

DBGET integrated database retrieval system