KEGG   Helicobacter pylori 26695: HP0928Help
Entry
HP0928            CDS       T00008                                 

Gene name
folE
Definition
(RefSeq) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
hpy  Helicobacter pylori 26695
Pathway
hpy00790  Folate biosynthesis
hpy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HP0928 (folE)
Enzymes [BR:hpy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     HP0928 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 899457
NCBI-ProteinID: NP_207720
UniProt: P56462
Position
991247..991789
Genome map
AA seq 180 aa AA seqDB search
MENFFNQFFESIGEDKNREGLKETPKRVQELWKFLYKGYKEDPRVALKSAYFQGVCDEMI
VAQNIEFYSTCEHHLLPFLGNISVGYIPKEKIVGISAIAKLIEIYSRRLQIQERLTIQIA
ETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLRGLFKKDSKTRAEFMQLLKS
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattttttcaaccagttttttgaaagtatcggcgaagataagaatcgagaaggc
ttgaaagaaacgcctaaaagggttcaagaattatggaaattcttgtataaaggctataaa
gaagatcctagagtggctttaaaaagcgcgtattttcaaggcgtttgcgatgaaatgata
gtggctcaaaacattgaattttactccacttgcgagcaccatttgctcccttttttgggg
aatattagcgtgggatatatccctaaggaaaagattgtaggcattagcgcgatcgctaaa
ctcattgaaatttatagcagacgcctacaaatccaagaaaggctgaccattcaaattgca
gaaacctttgatgaaatcatagagccaaggggcgtgatcgtggtttgtgaagccaagcat
ttgtgcatgagcatgcaaggggtgcaaaagcaaaatgcgatcattaaaacaagcgttcta
agaggcctctttaaaaaagactctaaaaccagagctgaatttatgcaactcttaaaatct
tag

DBGET integrated database retrieval system