KEGG   Helicobacter pylori 26695: HP1082Help
Entry
HP1082            CDS       T00008                                 

Definition
(RefSeq) multidrug ABC transporter ATP-binding protein/permease
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:3.6.3.-]
Organism
hpy  Helicobacter pylori 26695
Pathway
hpy02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hpy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    HP1082
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hpy02000]
    HP1082
Enzymes [BR:hpy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     HP1082
Transporters [BR:hpy02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    HP1082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N ABC_membrane_2 AAA_16 RsgA_GTPase AAA_29 AAA_22 DEAD G-alpha cobW ABC_ATPase Ribosomal_L10 AAA_30 AAA_5 DUF87
Motif
Other DBs
NCBI-GeneID: 899618
NCBI-ProteinID: NP_207873
UniProt: O25714
Position
complement(1140086..1141741)
Genome map
AA seq 551 aa AA seqDB search
MKLFFKRYSKYLKEHYKSFIVVLFSSLVVALSTAWGTYLVKPTLDEIFINKDTHMLKILP
FLVILAYLGKSGGMYLGTYFTNFIGLDIVKKIRNTMLESLLKMEMDFFNRTKKGELIARI
TNDIGLIRASLSNYLSESIREGLTIVGLVGVVIYQSPKLALVGLVIMPLAAIPISKIIRK
VKKLAKSHQESNAKITARLSEVFNNVEAIKISNGEKLEHKAFVKENEAFFKIGIKNIAVA
EISSPLMEFLGSIAIALVIYLGGNEVIRGHISVGAFFSFITALFMLYTPIKRLTRIVSNF
QEALVASDRIHEILEREPAIVDGELTLNNAIHTIEFKKVWLAYTLDNQERYVLNDISLKF
QQNEIIALKGESGSGKSSLVNLILRLYEPSKGEIFINDQKIESITQKSLREKISVVTQRV
FIFNGSVAENVAYGLEIDEVKIKECLKKAQALDFVEKMPHGIESVLDEFGANLSGGQRQR
IAIARALYKDVQVLIFDEATSALDNNTEESVKQSILELKQNRLIILISHNPSTLKLATKH
VKLEHGRLTEC
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactctttttcaagcgttattctaaataccttaaagagcattataaaagttttata
gtggttttattttcttctttagtggtggctttaagcacggcttgggggacttatttagtc
aagcccactttagatgaaatttttatcaataaagacactcacatgctcaaaatcctgcct
tttttagtgattttggcgtatttgggtaagagtgggggcatgtatttaggcacttatttc
accaacttcattgggcttgatattgtcaaaaaaatacgcaacactatgctagaaagcctt
cttaaaatggaaatggatttttttaacaggacgaaaaagggcgaattgatcgcaaggatc
accaatgatataggtttgattagagcgagtttgtccaattacctttcagagagcataaga
gaggggctaacgattgttgggttagtgggggtggtgatctatcaaagccctaaattagcg
ttagtggggttagtcatcatgccgttagctgctattcctatcagtaaaatcattcgtaag
gttaaaaaactcgctaaatcccatcaagagagtaacgccaaaatcaccgctcgtttgagt
gaagtttttaacaacgtggaagcgattaaaatctctaatggcgaaaaattagagcataag
gcttttgtgaaagaaaatgaagcgttttttaaaatcggtatcaaaaacatcgccgtggct
gaaatttcttcgcctttaatggagtttttaggttcaatcgctatagcgctagtgatttat
ttaggggggaatgaagtgattagaggccatattagcgtgggggcgtttttttctttcatt
acggccctttttatgctctatacgccgattaaacgcttaactaggattgtttctaatttt
caagaagccttagtcgctagcgacaggatccatgagattttagaaagagagccggctatt
gttgatggggaattgacgctaaataacgccatacacaccatagaatttaaaaaggtatgg
ctggcttatacgctagacaatcaagagcgttatgttttaaacgatattagtttgaagttc
caacaaaatgaaatcatcgctttaaagggcgaaagcgggagcggtaaaagctcattagtg
aatctgatcttacgcctttatgagccaagcaaaggcgaaattttcatcaacgatcaaaaa
atagagagcatcactcaaaaatccttaagagaaaagattagcgttgtcactcaaagggtg
tttatttttaacgggagcgtggctgaaaatgtggcgtatggtttagaaattgatgaggta
aaaatcaaagaatgcctaaaaaaagctcaagccttagattttgttgaaaaaatgcctcat
gggatagagagcgttttagatgaatttggcgctaatcttagcggcggccaacgccaaaga
atcgccattgcaagagctttgtataaagacgttcaagttttaatctttgatgaagccact
tccgctttagacaataacacagaagagagcgttaaacaaagcattttagaattgaaacaa
aaccgcttgatcattcttatttcgcacaacccaagcacgctaaaattagccactaagcat
gtgaaattagagcatgggcgtttgacagaatgctaa

DBGET integrated database retrieval system