KEGG   Helicobacter pylori 26695: HP1111Help
Entry
HP1111            CDS       T00008                                 

Definition
(RefSeq) pyruvate flavodoxin oxidoreductase subunit beta
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hpy  Helicobacter pylori 26695
Pathway
hpy00010  Glycolysis / Gluconeogenesis
hpy00020  Citrate cycle (TCA cycle)
hpy00620  Pyruvate metabolism
hpy00640  Propanoate metabolism
hpy00650  Butanoate metabolism
hpy00680  Methane metabolism
hpy01100  Metabolic pathways
hpy01120  Microbial metabolism in diverse environments
hpy01130  Biosynthesis of antibiotics
hpy01200  Carbon metabolism
Module
hpy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HP1111
   00020 Citrate cycle (TCA cycle)
    HP1111
   00620 Pyruvate metabolism
    HP1111
   00640 Propanoate metabolism
    HP1111
   00650 Butanoate metabolism
    HP1111
  Energy metabolism
   00680 Methane metabolism
    HP1111
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HP1111
Enzymes [BR:hpy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HP1111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C Myb_DNA-bind_4
Motif
Other DBs
NCBI-GeneID: 899647
NCBI-ProteinID: NP_207902
UniProt: O25739
Position
1172352..1173296
Genome map
AA seq 314 aa AA seqDB search
MVKEVKTLKGFSQSAEKFQGSHLLCPGCGHGIIVREVLNAVDGPIVLGNSTGCLEVCSAV
YPHTSWDVPWIHIGFENGSTAISGVEAMYKALTNKGRYQGQKPKFVAFGGDGASYDIGLQ
FISGCMERGHDMTYICLDNENYANTGGQRSGSTPLGASTSTTPAGSVSFGKKEKKKDIVN
IMASHGVPYVAQLSPNKWKDMNKKIKTALDTEGPCFINALSPCTTEWKFESNKTIELADM
AVDSLMFPLFEIFNGRELKITYRPRNIIPVRDYLGAQKRFKHLFKKENEHIIEELQKDVN
ERWEYLQRREEAKV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagtcaaaacactcaaaggttttagccaaagcgctgagaaatttcaaggc
tcgcacttgctttgcccaggttgtgggcatggcattattgtgcgcgaagttttaaacgct
gtagatgggcctattgttttaggcaattctaccggttgtttagaggtatgctcggctgtg
tatccgcacacttcatgggatgtgccttggattcatattggttttgaaaatggctctacg
gcgatttcaggggtggaagcgatgtataaagcgcttacgaataagggccgttatcaaggt
caaaaaccaaaatttgtggcgtttgggggcgatggggccagttatgatattggtcttcaa
ttcatcagcggttgcatggaaagagggcatgacatgacttacatttgcctagataatgaa
aactacgccaataccggcggtcaaagaagcggctctacgccattaggggctagcacttct
accacgccagcgggatcagtgagctttggtaagaaagaaaagaaaaaagacatcgtcaat
atcatggcaagccatggagtcccttatgtggcgcagctctcgcctaacaaatggaaagac
atgaacaaaaagattaaaaccgcgctagacactgaagggccttgctttattaacgctctt
agcccatgcacgactgaatggaaatttgaatccaataaaaccattgaattagcggatatg
gctgtggatagcttgatgttccccttatttgaaatctttaatggcagggaattgaaaatc
acttaccgccctagaaatatcattcctgtaagggattatttaggggctcaaaaacgcttc
aaacaccttttcaaaaaagaaaacgaacacatcattgaagaattgcaaaaagatgtgaat
gagcgttgggaatacttgcaacgcagagaagaagctaaagtataa

DBGET integrated database retrieval system