KEGG   Helicobacter pylori 26695: HP1205Help
Entry
HP1205            CDS       T00008                                 

Gene name
tuf
Definition
(RefSeq) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
hpy  Helicobacter pylori 26695
Brite
Translation factors [BR:hpy03012]
 Eukaryotic Type
  Elongation factors
   HP1205 (tuf)
 Prokaryotic Type
   HP1205 (tuf)
Mitochondrial biogenesis [BR:hpy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HP1205 (tuf)
Exosome [BR:hpy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HP1205 (tuf)
  Exosomal proteins of breast cancer cells
   HP1205 (tuf)
  Exosomal proteins of colorectal cancer cells
   HP1205 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 899043
NCBI-ProteinID: NP_207997
UniProt: P56003
Position
complement(1280679..1281878)
Genome map
AA seq 399 aa AA seqDB search
MAKEKFNRTKPHVNIGTIGHVDHGKTTLSAAISAVLSLKGLAEMKDYDNIDNAPEEKERG
ITIATSHIEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPHIVVFLNKQDMVDDQELLELVEMEVRELLSAYEFPGDDTPIVAGSALRALE
EAKAGNVGEWGEKVLKLMAEVDAYIPTPERDTEKTFLMPVEDVFSIAGRGTVVTGRIERG
VVKVGDEVEIVGIRPTQKTTVTGVEMFRKELEKGEAGDNVGVLLRGTKKEEVERGMVLCK
PGSITPHKKFEGEIYVLSKEEGGRHTPFFTNYRPQFYVRTTDVTGSITLPEGVEMVMPGD
NVKITVELISPVALELGTKFAIREGGRTVGAGVVSNIIE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttaacagaactaagccgcatgttaatattggaaccattgggcat
gtagaccatggtaaaacgactttgagtgcagcgatttcagcggtgctttctttgaaaggt
cttgcagaaatgaaagactatgataatattgataacgcccctgaagaaaaagaaagaggg
atcactatcgctacttctcacattgaatatgagactgaaaacagacactatgcgcatgtg
gattgcccaggacacgctgactatgtaaaaaacatgatcaccggtgcggcgcaaatggac
ggagcgattttggttgtttctgcagctgatggccctatgcctcaaactagggagcatatc
ttattgtctcgtcaagtaggcgtgcctcacatcgttgttttcttaaacaaacaagacatg
gtagatgaccaagaattgttagaacttgtagaaatggaagtgcgcgaattgttgagcgcg
tatgaatttcctggcgatgacactcctatcgtagcgggttcagctttaagagctttagaa
gaagcaaaggctggtaatgtgggtgaatggggtgaaaaagtgcttaaacttatggctgaa
gtggatgcctatatccctactccagaaagagacactgaaaaaactttcttgatgccggtt
gaagatgtgttctctattgcgggtagagggactgtggttacaggtaggattgaaagaggc
gtggtgaaagtaggcgatgaagtggaaatcgttggtatcagacctacacaaaaaacgact
gtaaccggtgtagaaatgtttaggaaagagttggaaaaaggtgaagccggcgataatgtg
ggcgtgcttttgagaggaactaaaaaagaagaagtggaacgcggtatggttctatgcaaa
ccaggttctatcactccgcacaagaaatttgagggagaaatttatgtcctttctaaagaa
gaaggcgggagacacactccattcttcaccaattaccgcccgcaattctatgtgcgcaca
actgatgtgactggctctatcacccttcctgaaggcgtagaaatggttatgcctggcgat
aatgtgaaaatcactgtagagttgattagccctgttgcgttagagttgggaactaaattt
gcgattcgtgaaggcggtaggaccgttggtgctggtgttgtgagcaatattattgaataa

DBGET integrated database retrieval system