KEGG   Helicobacter pylori 26695: HP1243
Entry
HP1243            CDS       T00008                                 

Definition
(RefSeq) membrane protein
  KO
K15847  outer membrane protein BabA
Organism
hpy  Helicobacter pylori 26695
Pathway
hpy05120  Epithelial cell signaling in Helicobacter pylori infection
Brite
KEGG Orthology (KO) [BR:hpy00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HP1243
SSDB
Motif
Pfam: SabA_adhesion HP_OMP RmuC
Other DBs
NCBI-GeneID: 898891
NCBI-ProteinID: NP_208035
UniProt: O25840
Position
complement(1317838..1320039)
AA seq 733 aa
MKKHILSLALGSLLVSTLSAEDDGFYTSVGYQIGEAAQMVTNTKGIQQLSDNYENLNNLL
TRYSTLNTLIKLSADPSAINAVRENLGASAKNLIGDKANSPAYQAVLLAINAAVGFWNVV
GYVTQCGGNANGQESTSSTTIFNNEPGYRSTSITCSLNGHKPGYYGPMSIENFKKLNEAY
QILQTALKNGLPALKENNGKVSVTYTYTCSGQGNNNCSPSVNGTKTTTQTIDGKSVTTTI
SSKVVGSIASGNTSHVITNKLDGVPDSAQALLAQASTLINTINEACPYFHATNSSEANAP
KFSTTTGKICGAFSEEISAIQKMITDAQELVNQTSVINSNEQSTPVGNNNGKPFNPFTDA
SFAQGMLANASAQAKMLNLAHQVGQAINPENLSENFKNFVTGFLATCNNKSTAGTGGTQG
SAPGTVTTQTFASGCAYVEQTLTNLGNSIAHFGTQEQQIQQAENIADTLVNFKSRYSELG
NTYNSITTALSKVPNAQSLQNVVSKKNNPYSPQGIETNYYLNQNSYNQIQTINQELGRNP
FRKVGIVNSQTNNGAMNGIGIQVGYKQFFGQKRKWGARYYGFFDYNHAFIKSSFFNSASD
VWTYGFGADALYNFINDKATNFLGKNNKLSLGLFGGIALAGTSWLNSEYVNLATVNNVYN
AKMNVANFQFLFNMGVRMNLARSKKKGSDHAAQHGIELGLKIPTINTNYYSFMGAELKYR
RLYSVYLNYVFAY
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgaaaaaacacatcctttcattagctttaggctcgcttttagtttccactttgagcgct
gaagacgacggcttttacacaagcgtaggctatcagatcggtgaagccgctcaaatggta
acaaacaccaaaggcatccaacagctttcagacaattatgaaaatttgaacaacctttta
acgagatacagcaccctaaacacccttatcaaattgtccgctgatccgagcgcaattaat
gcggtgcgggaaaatctgggcgcgagcgcgaagaatttgatcggcgataaagccaactcc
cccgcctatcaagccgtgcttttagcgatcaacgcggcggtagggttttggaatgtcgtg
ggctatgtgacgcaatgtgggggtaacgccaatggtcaagaaagcacctcttcaaccacc
atcttcaacaacgagccagggtatcgatccacttccatcacttgttctttgaacgggcat
aagcctggatactatggccctatgagcattgagaattttaaaaagcttaacgaagcctat
cagatcctccaaacggctttaaaaaacggcttacccgcgctcaaagaaaacaacgggaag
gtcagtgtaacctatacctacacatgctcagggcaagggaataataactgctcgccaagt
gtcaacggaaccaaaaccacaacccaaaccatagacggcaaaagcgtaaccaccacgatc
agttcaaaagtggttggtagcatcgctagtggcaacacatcacatgtcatcaccaacaaa
ttagacggtgtgcctgatagcgctcaagcgctcttagcgcaagcgagcacgctcatcaac
accatcaacgaagcatgcccgtatttccatgctactaatagtagtgaggctaacgcccca
aaattctctactactactgggaaaatatgcggcgctttttcagaagaaatcagcgcgatc
caaaagatgatcacggacgcgcaagagctagttaatcaaacgagcgtcattaacagcaac
gaacaatcaactccggtaggcaataataatggcaagcctttcaaccctttcacggacgca
agttttgcgcaaggcatgctcgctaacgctagcgcgcaagctaaaatgctcaatttagcc
catcaggtggggcaagccattaacccagagaatcttagcgagaattttaaaaattttgtt
acaggctttttagccacatgcaataacaaatcaacagctggcactggtggcacacaaggt
tcagctccaggcacagtgaccactcaaactttcgcttctggttgcgcgtatgtggagcaa
accctaacgaacttaggcaacagcatcgctcactttggcactcaagagcagcagatacag
caagccgaaaacatcgctgacactctagtgaatttcaaatctagatacagcgaattaggc
aacacctataacagcatcaccaccgcgctctccaaagtccctaacgcgcaaagcttgcaa
aacgtggtgagcaaaaagaataacccctatagccctcaaggcatagagaccaattactac
ctcaatcaaaattcttacaaccaaatccaaaccatcaaccaagaactagggcgtaacccc
tttaggaaagtgggcatcgtcaattctcaaaccaacaatggtgccatgaatgggatcggt
attcaggtgggctataagcaattctttggccaaaaaagaaaatggggcgctaggtattac
ggcttttttgattacaaccatgcgttcatcaaatccagctttttcaactcggcttctgac
gtgtggacttatggttttggagcggacgcgctttataacttcatcaacgataaagccacc
aatttcttaggcaaaaacaacaagctttctttggggctttttggcgggattgcgttagcg
ggcacttcatggctcaattctgagtacgtgaatttagccaccgtgaataacgtctataac
gctaaaatgaatgtggcgaatttccaattcttattcaatatgggagtgaggatgaattta
gccagatccaagaaaaaaggcagcgatcatgcagctcagcatgggattgagttagggctt
aaaatccccaccatcaacacgaactattattcctttatgggggctgaactcaaatacaga
aggctctatagcgtgtatttgaactatgtgttcgcttactaa

DBGET integrated database retrieval system