KEGG   Helicobacter pylori 26695: HP1338Help
Entry
HP1338            CDS       T00008                                 

Definition
(RefSeq) nickel responsive regulator
  KO
K07722  CopG family transcriptional regulator, nickel-responsive regulator
Organism
hpy  Helicobacter pylori 26695
Brite
KEGG Orthology (KO) [BR:hpy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hpy03000]
    HP1338
Transcription factors [BR:hpy03000]
 Prokaryotic Type
  Ribbon-helix-helix
   CopG family
    HP1338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NikR_C RHH_1 RHH_8 FAM219A
Motif
Other DBs
NCBI-GeneID: 900339
NCBI-ProteinID: NP_208130
UniProt: O25896
Structure
PDB: 

Position
complement(1398327..1398773)
Genome map
AA seq 148 aa AA seqDB search
MDTPNKDDSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWAEDNPN
DESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEI
QRLQLEIGGLRGVKFAKLTKASSFEYNE
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggatacacccaataaagacgattcaatcatccgcttttcggtttctttacaacaaaat
ttattagacgaattagacaaccgcatcattaaaaacggctattcttctcgatcagaatta
gtgcgcgacatgatcagagaaaaattagtagaagacaattgggcagaagacaaccctaat
gacgagagcaaaatcgccgtgcttgtggtgatttatgatcaccaccaaagggaattaaac
cagcgcatgatagacattcagcatgccagcgggacgcatgttttatgcaccacgcacatt
cacatggatgagcataattgcttggagacgattattttacaaggcaattcgtttgaaatc
caacgcttgcaattggaaattggggggcttaggggggttaaattcgctaaattgactaag
gcgtctagctttgaatacaatgaatag

DBGET integrated database retrieval system