KEGG   Helicobacter pylori 26695: HP1571Help
Entry
HP1571            CDS       T00008                                 

Definition
(RefSeq) rare lipoprotein A RlpA
  KO
K03642  rare lipoprotein A
Organism
hpy  Helicobacter pylori 26695
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DPBB_1 SPOR DUF3293
Motif
Other DBs
NCBI-GeneID: 899720
NCBI-ProteinID: NP_208362
UniProt: O26091
Position
complement(1651704..1652651)
Genome map
AA seq 315 aa AA seqDB search
MGLALEKVCFLGVIFLISACTVKKEGVKNLSYKHESLRAYENAKDYDPTTKKAAYKRNFF
ERHFKRYSDSQDSNTKDQPLDNGMRDSSSIQRATMRPYQVGGKWYYPTKVDLGEKFDGVA
SWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTVVKVINVDNNLSTIVRINDRGPFVSD
RIIDLSNAAARDIDMVKKGTASVRLIVLGFGGVISTQYEQSFNASSSKILHKEFKVGESE
KSVSGGKFSLQMGAFRNQIGAQTLADKLQAENPNYSVKVAFKDDLYKVLVQGFQSEEEAR
DFMKKYNQNAVLTRE
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgggtttggcgttggaaaaagtttgttttttaggcgttatttttttgattagcgcttgc
acggttaaaaaagagggggtaaagaatttgtcttacaagcatgaaagcttgcgcgcttat
gaaaacgctaaagattatgatccgacaaccaaaaaagccgcctataaacgcaattttttt
gaacgccatttcaaacgctactccgattcgcaagatagcaacacaaaagatcagccacta
gataacggcatgcgcgattctagctcgatccaaagagccaccatgcgcccttatcaagtg
gggggcaagtggtattaccccactaaagtggatttaggcgaaaaatttgatggcgttgcg
agttggtatggccctaacttccatgccaaaaaaaccagtaatggggaaatttataacatg
tatgcccacaccgccgcgcacaaaactttacccatgaacaccgtggtgaaagtcatcaat
gttgataataacttaagcaccattgtgcgcatcaacgatagagggccttttgtgagcgat
cgcatcattgatttgtctaatgcggccgctagggatattgacatggttaaaaaaggcaca
gccagcgtgcgtctcattgttttgggctttggtggggttatctccacgcaatacgaacaa
tcctttaacgccagctcttcaaagatcttgcacaaggaatttaaagtcggcgagagcgaa
aaaagcgtgagcggagggaaattttctttgcaaatgggggcttttagaaaccaaataggt
gctcaaactttagcggataaattgcaagcagaaaatccaaattacagcgtcaaggttgct
tttaaagacgatttgtataaagttttagttcaagggtttcaaagcgaagaagaggctagg
gattttatgaaaaaatacaaccagaatgcggttttaacgagagaatga

DBGET integrated database retrieval system