KEGG   Helicobacter pylori Aklavik117: HPAKL117_00415Help
Entry
HPAKL117_00415    CDS       T02352                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
hpya  Helicobacter pylori Aklavik117
Pathway
hpya00020  Citrate cycle (TCA cycle)
hpya00620  Pyruvate metabolism
hpya01100  Metabolic pathways
hpya01110  Biosynthesis of secondary metabolites
hpya01120  Microbial metabolism in diverse environments
hpya01130  Biosynthesis of antibiotics
hpya01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HPAKL117_00415
   00620 Pyruvate metabolism
    HPAKL117_00415
Enzymes [BR:hpya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     HPAKL117_00415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 NAD_binding_8 Pyr_redox_3 Pyr_redox Lycopene_cycl FAD_binding_2 Thi4 PEX-1N K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AFX90502
UniProt: K7YQC7
Position
complement(87634..88986)
Genome map
AA seq 450 aa AA seqDB search
MSMEFDAVIIGGGVSGCATFYTLSEYSSLKRVAIVEKCSKLAQISSSAKANSQTIHDGSI
ETNYTPEKAKKVRLSAYKTRQYALNKGLQNEVIFETQKMAIGVGDEECEFMKKRYESFKE
IFVGLEEFDKQKIKELEPNVILGANGTDRHENIIGHGYQKDWSTMNFAKLSENFVEEALK
LKPNNQVFLNFKVKKIEKRNDTYALISEDAEEVYAKFVLVNAGSYALPLAQSMGYGLDLG
CLPVAGSFYFVPDLLRGKVYTVQNPKLPFAAVHGDPDAVIKGKTRIGPTALTMPKLERNK
CWLKGISLELLKMDLNKDVFKIAFDLMSDKEIRNYVLKNMVFELPIIGKRKFLKDAQKII
PSLSLEDLEYAHGFGEVRPQVLDKTKRKLELGEKKICTHKGITFNMTPSPGATSCLQNAL
VDSQEIAAYLGESFELERFYKDLSPEELEN
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggaatttgatgctgttattattggaggtggggtttcagggtgcgcaaccttt
tatactttgagcgaatacagctctttaaagcgcgtggctatcgtggaaaaatgctctaaa
ttagctcaaatcagctctagcgctaaagctaattcacaaaccattcatgatggctctatt
gaaacgaattacactcccgaaaaagctaaaaaagtgcgtttgagcgcttataaaaccagg
caatacgcgctcaataaaggcttgcaaaatgaagtgatttttgaaacccagaaaatggct
ataggcgtgggcgatgaagaatgcgagttcatgaaaaaacgctatgaatcctttaaagaa
atctttgtggggttagaagaatttgacaaacaaaagattaaagaattagagcctaatgtg
attttaggggctaatggcacagacaggcatgaaaacattatcgggcatggttatcaaaaa
gattggagcacgatgaattttgcaaagttgagcgaaaacttcgttgaagaagccctaaaa
ttaaagcctaacaaccaggtgtttttgaatttcaaagtgaaaaagattgaaaaacgcaac
gacacttacgcgctcatttcagaagacgctgaagaagtgtatgctaaattcgtgctggtc
aatgccggctcttacgctttgcctttggctcagagcatgggttatggcttggatttaggg
tgcttgcctgtggcgggtagcttttattttgtgccggatttattaaggggtaaggtttat
accgttcaaaaccctaaactcccttttgcagccgtgcatggcgacccagatgccgtcatt
aaaggaaaaacacgaatcgggcctaccgctttaacgatgcccaaattagaacgaaacaaa
tgctggcttaagggtattagcttggaattgttgaaaatggatttgaataaagatgtgttt
aagattgcgtttgatttgatgagcgataaagaaatccgtaattatgtgcttaaaaacatg
gtttttgaattgcccattatcggcaaaaggaaatttttaaaagacgctcaaaaaatcatc
ccctctcttagcctagaagatttagaatacgctcatggttttggcgaagtgcgcccgcaa
gttttagacaaaaccaagcgaaagctggaattaggcgaaaaaaagatttgcacccataaa
ggcatcacttttaacatgaccccctctccaggcgcgacgagttgcttgcaaaacgccctt
gtggattcccaagaaatcgctgcgtatttgggcgagagctttgaattagaacgcttttat
aaagatttatccccagaagaattagaaaattaa

DBGET integrated database retrieval system