KEGG   Helicobacter pylori Aklavik117: HPAKL117_00880Help
Entry
HPAKL117_00880    CDS       T02352                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
hpya  Helicobacter pylori Aklavik117
Pathway
hpya00010  Glycolysis / Gluconeogenesis
hpya00030  Pentose phosphate pathway
hpya00051  Fructose and mannose metabolism
hpya00680  Methane metabolism
hpya01100  Metabolic pathways
hpya01110  Biosynthesis of secondary metabolites
hpya01120  Microbial metabolism in diverse environments
hpya01130  Biosynthesis of antibiotics
hpya01200  Carbon metabolism
hpya01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPAKL117_00880
   00030 Pentose phosphate pathway
    HPAKL117_00880
   00051 Fructose and mannose metabolism
    HPAKL117_00880
  09102 Energy metabolism
   00680 Methane metabolism
    HPAKL117_00880
Enzymes [BR:hpya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     HPAKL117_00880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: AFX90593
UniProt: K7YC47
Structure
PDB: 

Position
177444..178367
Genome map
AA seq 307 aa AA seqDB search
MLVKGNEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMGIDM
AVGMVKIMCERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEENLELTSKV
VKMAHNAGVSVEAELGRLMGIEDNISVDEKDAVLVNPKEAEQFVKESQVDYLAPAIGTSH
GAFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGVPFEF
LQESVKGGINKVNTDTDLRIAFIAEVRKVANEDKSQFDLRKFFSPAQLALKNVVKERMKL
LGSTNKI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgttagttaaaggcaatgaaatcttactgaaggcccataaagaaggctatggggtaggg
gcgtttaatttcgtgaattttgaaatgctaaacgctatttttgaagcaggaaatgaggaa
aattctccgcttttcattcaagcgagtgaaggagcgatcaaatacatggggattgatatg
gcggtgggcatggtgaaaatcatgtgcgaacgctacccgcacattcctgtagccctacac
ctagatcatggcacgacttttgaaagctgtgaaaaagccgtgaaagcgggtttcacttct
gtgatgattgatgcgtctcatcatgcttttgaagaaaatttggaattgacttctaaagtg
gtcaaaatggcgcataacgctggagtgagcgtggaagcggagttggggcgtttaatgggg
attgaagacaatatttcagtggatgaaaaagacgcggtgttagtgaatcctaaagaagcg
gagcagtttgtcaaagaatctcaagtggattacttagccccagccattgggacaagccat
ggagcgtttaagtttaagggcgagcccaaattggattttgaacgcttgcaagaagtcaaa
aggctcactaatatccctttagttttgcatggagcgagcgcgataccagataatgtgagg
aagtcttatttggatgctggaggcgatttgaaaggctctaagggcgtgccttttgaattt
ttacaagaatccgtgaaaggggggatcaataaggtcaataccgacacggatttaaggatc
gctttcatcgcagaagtgcgcaaggtggctaacgaagataagagccaatttgatttgagg
aagtttttttctccggcccaattagcacttaaaaatgtggtcaaagagcgcatgaaactt
ttgggcagcactaataaaatttaa

DBGET integrated database retrieval system