KEGG   Helicobacter pylori Aklavik117: HPAKL117_03260Help
Entry
HPAKL117_03260    CDS       T02352                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpya  Helicobacter pylori Aklavik117
Pathway
hpya00071  Fatty acid degradation
hpya00072  Synthesis and degradation of ketone bodies
hpya00280  Valine, leucine and isoleucine degradation
hpya00310  Lysine degradation
hpya00362  Benzoate degradation
hpya00380  Tryptophan metabolism
hpya00620  Pyruvate metabolism
hpya00630  Glyoxylate and dicarboxylate metabolism
hpya00640  Propanoate metabolism
hpya00650  Butanoate metabolism
hpya00900  Terpenoid backbone biosynthesis
hpya01100  Metabolic pathways
hpya01110  Biosynthesis of secondary metabolites
hpya01120  Microbial metabolism in diverse environments
hpya01130  Biosynthesis of antibiotics
hpya01200  Carbon metabolism
hpya01212  Fatty acid metabolism
hpya02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPAKL117_03260
   00630 Glyoxylate and dicarboxylate metabolism
    HPAKL117_03260
   00640 Propanoate metabolism
    HPAKL117_03260
   00650 Butanoate metabolism
    HPAKL117_03260
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPAKL117_03260
   00072 Synthesis and degradation of ketone bodies
    HPAKL117_03260
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPAKL117_03260
   00310 Lysine degradation
    HPAKL117_03260
   00380 Tryptophan metabolism
    HPAKL117_03260
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPAKL117_03260
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPAKL117_03260
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPAKL117_03260
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpya04147]
    HPAKL117_03260
Enzymes [BR:hpya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPAKL117_03260
Exosome [BR:hpya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPAKL117_03260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF840
Motif
Other DBs
NCBI-ProteinID: AFX91063
UniProt: K7YD91
Position
684491..685666
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAIGSFLGSLKSVGAREMGAVVLKDALKASGLKPNDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGHGEVVVCGGVENMSM
APYLSFDMRDGKRMGNANMIDSMICDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAQKAQKLGLKAMATIKGFGLGACSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSAHSVGCASLCVGGGQGLSVIVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctatagggagttttttaggttct
ctaaaaagcgtgggcgctagagaaatgggtgctgtcgtgcttaaagacgctctgaaggcg
agcggtcttaagcctaacgatgtggattctgtcattttaggcaatgttttatccgccggt
ttgggtcaaaatatcgccagacagatccaactggacgctggcataccgaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgat
agcatcatgcttgggcatggtgaggtggtggtgtgcggtggcgtggaaaacatgagcatg
gcaccctatctgtcgtttgacatgcgagatgggaaaagaatggggaatgcaaacatgata
gactccatgatctgtgatggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgctttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcagggaaattccaagaagaaatcacg
cctattgaaatagcgaataaaaaaggtgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcgct
caaaaagcgcaaaaattggggttaaaagcaatggcaactatcaaggggtttggtttgggt
gcttgcagtccggatataatggggatatgccctagcatcgctattaaaaacaaccttaaa
aatgtcaaaatgaatctcaacgacatcaatctttttgaactcaatgaagcctttgctgcg
caaagcatagccgtgttaaaagagcttgaattaaaccctaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggtgcgagcggcgctaggatcttggtaacttta
ttgcatgaaatgaaaagaagcgctcatagcgtgggctgcgcgtcattgtgtgtgggcggc
ggacaagggctatcagtaatagtggaacaaaaataa

DBGET integrated database retrieval system