KEGG   Helicobacter pylori Aklavik117: HPAKL117_05195Help
Entry
HPAKL117_05195    CDS       T02352                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hpya  Helicobacter pylori Aklavik117
Pathway
hpya00010  Glycolysis / Gluconeogenesis
hpya00020  Citrate cycle (TCA cycle)
hpya00620  Pyruvate metabolism
hpya00640  Propanoate metabolism
hpya00650  Butanoate metabolism
hpya00680  Methane metabolism
hpya01100  Metabolic pathways
hpya01120  Microbial metabolism in diverse environments
hpya01130  Biosynthesis of antibiotics
hpya01200  Carbon metabolism
Module
hpya_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPAKL117_05195 (porD)
   00020 Citrate cycle (TCA cycle)
    HPAKL117_05195 (porD)
   00620 Pyruvate metabolism
    HPAKL117_05195 (porD)
   00640 Propanoate metabolism
    HPAKL117_05195 (porD)
   00650 Butanoate metabolism
    HPAKL117_05195 (porD)
  Energy metabolism
   00680 Methane metabolism
    HPAKL117_05195 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPAKL117_05195 (porD)
Enzymes [BR:hpya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPAKL117_05195 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_2 Fer4_7 Fer4_9 Fer4_17 Fer4_16 Fer4_15 Fer4_8 Fer4_4 Fer4_13 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AFX91433
UniProt: K7YE48
Position
1097071..1097463
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIDPASALTQ
WPQKEEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaaaaacgcg
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagctacttcacc
acttcagtggctcattggcgcgtggctaagcctgtgcataacaataacatttgcatcaac
tgctttaattgttgggtttattgcccagatgctgctattctctcaagagagggcaagtta
aaaggcgtggattattctcattgtaaaggctgtggcgtgtgcgtggatgtctgccccacc
aaccctaaatcgctatggatgtttgaagaacaaattgatcctgctagcgctcttactcaa
tggccgcaaaaagaagaaaagaaaaaatcataa

DBGET integrated database retrieval system