KEGG   Helicobacter pylori Aklavik117: HPAKL117_06055Help
Entry
HPAKL117_06055    CDS       T02352                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpya  Helicobacter pylori Aklavik117
Pathway
hpya00010  Glycolysis / Gluconeogenesis
hpya00030  Pentose phosphate pathway
hpya00051  Fructose and mannose metabolism
hpya00052  Galactose metabolism
hpya00230  Purine metabolism
hpya00500  Starch and sucrose metabolism
hpya00520  Amino sugar and nucleotide sugar metabolism
hpya00521  Streptomycin biosynthesis
hpya01100  Metabolic pathways
hpya01110  Biosynthesis of secondary metabolites
hpya01120  Microbial metabolism in diverse environments
hpya01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPAKL117_06055
   00030 Pentose phosphate pathway
    HPAKL117_06055
   00051 Fructose and mannose metabolism
    HPAKL117_06055
   00052 Galactose metabolism
    HPAKL117_06055
   00500 Starch and sucrose metabolism
    HPAKL117_06055
   00520 Amino sugar and nucleotide sugar metabolism
    HPAKL117_06055
  Nucleotide metabolism
   00230 Purine metabolism
    HPAKL117_06055
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPAKL117_06055
Enzymes [BR:hpya01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPAKL117_06055
    5.4.2.8  phosphomannomutase
     HPAKL117_06055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFX91596
UniProt: K7YCW8
Position
1273855..1275231
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKSAFSIGVELGKIMREYDKSVFVGHDARVHGRSLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEIDGIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEIKPLKETPEKANALEAYQRYLIKDFEHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFNSLYSEPNGNFPNHHPDPSEAKNLQDLEKHMQENAISIGFAF
DGDADRIAMLSSHHVYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINAFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQTPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQETLKNPPNNFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKRALLNLLEK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatatgatattagaggcatttaccccaccactttagat
gaaaagagcgcctttagtatcggcgtggagttagggaaaatcatgcgagaatacgataaa
agcgtgtttgtagggcatgacgccagggtgcatgggcgatcgctttttgaagctttgagc
gcggggttacaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatagatggcatccaatgccccaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacactcaatcaaaacccg
ttttatggcaaggacattcaagctttaaaagacacgcttttaaacgccaagcatgaaata
aaacccctaaaagaaacaccagagaaagccaatgccctagaagcgtatcagcgctatttg
atcaaggattttgagcatttaaaaaaccttaaatacaaaatcgccctggattttggtaat
ggcgtgggagcgttaggcttagagcctattttaaaggctttaaacattgattttaatagc
ctttatagcgagcctaatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttacaagatttagaaaaacacatgcaagaaaacgctatttctataggctttgctttt
gatggcgatgcggacaggattgcgatgttaagctctcatcatgtttatgctggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgattaatgcttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgctattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgcttgaacaaaccccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacctgcaagaaacgcttaaaaacccgccaaataat
ttccctaaaatcaaagaaataatcagcattgatggcgtgagagtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccactccgtatttagtcagccgctttgaaggcaag
gatgaaacaacggcgttagagtataaaagagcgctgctcaatttgctagagaaataa

DBGET integrated database retrieval system