KEGG   Helicobacter pylori oki112: HPOKI112_03590Help
Entry
HPOKI112_03590    CDS       T03723                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpyc  Helicobacter pylori oki112
Pathway
hpyc00071  Fatty acid degradation
hpyc00072  Synthesis and degradation of ketone bodies
hpyc00280  Valine, leucine and isoleucine degradation
hpyc00310  Lysine degradation
hpyc00362  Benzoate degradation
hpyc00380  Tryptophan metabolism
hpyc00620  Pyruvate metabolism
hpyc00630  Glyoxylate and dicarboxylate metabolism
hpyc00640  Propanoate metabolism
hpyc00650  Butanoate metabolism
hpyc00900  Terpenoid backbone biosynthesis
hpyc01100  Metabolic pathways
hpyc01110  Biosynthesis of secondary metabolites
hpyc01120  Microbial metabolism in diverse environments
hpyc01130  Biosynthesis of antibiotics
hpyc01200  Carbon metabolism
hpyc01212  Fatty acid metabolism
hpyc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPOKI112_03590
   00630 Glyoxylate and dicarboxylate metabolism
    HPOKI112_03590
   00640 Propanoate metabolism
    HPOKI112_03590
   00650 Butanoate metabolism
    HPOKI112_03590
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPOKI112_03590
   00072 Synthesis and degradation of ketone bodies
    HPOKI112_03590
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPOKI112_03590
   00310 Lysine degradation
    HPOKI112_03590
   00380 Tryptophan metabolism
    HPOKI112_03590
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPOKI112_03590
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPOKI112_03590
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPOKI112_03590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpyc04147]
    HPOKI112_03590
Enzymes [BR:hpyc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPOKI112_03590
Exosome [BR:hpyc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPOKI112_03590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHN36159
UniProt: X2HSL8
Position
complement(710339..711514)
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGAVVLKDALKASGLKPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQRKARVAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAQKAQKLGLRTMAAIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSAHSVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgcagtggggagttttttaggctct
ctaaagagcgtgggtgctagagaaatgggcgctgtcgtgcttaaagacgctttgaaggcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttatccgctggt
ttgggtcaaaatatcgccagacagatccaactggacgctggcataccgaatgataggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggagaatatgagtgca
gccccctatttgtcgtttgacatgcgagatgggaaaagaatggggaatgcgaacatgata
gattccatgatccatgacggattatgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgctttcgcgctc
caatcgcaacgcaaagcaagagtcgccattaatgcagggaaattccaagaagagatcacg
cccattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagtgct
caaaaagcgcaaaaattgggcttaagaacaatggcggctatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattaaaaacaatcttaaa
aatgtcaaaatgaatctcaatgacatcaatctttttgaactcaatgaagctttcgccgcg
caaagcatagccgtattaaaagagcttgaattaaaccctaatatcgtgaatgtgaatgga
ggcgcgatagctattggccaccctattggtgcaagcggcgctaggattttagtaacttta
ttgcatgaaatgaaaagaagcgctcatagcgtgggttgcgcgtcattgtgtgtgggtggc
ggacaagggctatcagtagtagtggaacaaaaataa

DBGET integrated database retrieval system