KEGG   Helicobacter pylori oki112: HPOKI112_04895Help
Entry
HPOKI112_04895    CDS       T03723                                 

Definition
(GenBank) stationary phase survival protein SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
hpyc  Helicobacter pylori oki112
Pathway
hpyc00230  Purine metabolism
hpyc00240  Pyrimidine metabolism
hpyc00760  Nicotinate and nicotinamide metabolism
hpyc01100  Metabolic pathways
hpyc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpyc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HPOKI112_04895
   00240 Pyrimidine metabolism
    HPOKI112_04895
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    HPOKI112_04895
Enzymes [BR:hpyc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     HPOKI112_04895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: AHN36389
UniProt: X2HT43
Position
1001160..1001963
Genome map
AA seq 267 aa AA seqDB search
MKKILLTNDDGYHAKGIKALEQALGEMAEIYVVAPKHEKSACSQCITITAPLRAEKIKGK
EGRHYRIDDGTPSDCVYLAINELFKHVSFDLVISGINLGSNMGEDTIYSGTVAGAIEGTI
QGVPSIAISQILSNKNKNTPLSFDLAQKIIQDLVQNIFTKGYPLKGRKLLNVNVPNCSLQ
EYKGECITPKGYRLYKKEVHKRTDPKNESYFWLGLHPLEWQKRENEDRLSDFDAIASNLA
SITPLNLDLTSYDDLKNLESWHKGMLK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattttactcaccaacgatgatggctaccatgcaaaaggcattaaagcttta
gaacaagctttaggagaaatggcagaaatttatgtggtcgcccctaagcatgaaaaaagc
gcatgctcgcaatgcatcaccatcactgcacctttaagagcggagaaaattaagggcaaa
gaaggcaggcattataggattgatgatggcacgccaagcgattgcgtgtatctagcgatc
aatgagcttttcaaacatgtctcttttgatttagtgatttcagggatcaatcttggatct
aacatgggcgaagacacgatttattcgggaacggtggctggagcgattgaaggcaccatt
cagggcgtgccttccattgcgatttctcaaatcctttctaacaaaaacaaaaacacgccc
ctaagttttgatctggctcaaaagatcatccaggatttagtccaaaacatcttcaccaaa
ggctaccctttaaaagggcgcaaactcctaaatgtgaatgtccctaattgctccttacaa
gaatataagggcgaatgcatcacccctaaaggctataggctgtataaaaaagaagtgcat
aagcgcacagaccccaaaaacgaaagctatttttggctagggttacaccctttagaatgg
caaaagcgcgaaaatgaagacagactctctgattttgacgctattgcttcaaaccttgct
tctatcacgcctttaaatttagacttaaccagttatgatgatttgaaaaatttggaatct
tggcataagggaatgttaaagtga

DBGET integrated database retrieval system