KEGG   Helicobacter pylori oki128: HPOKI128_00510Help
Entry
HPOKI128_00510    CDS       T03724                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
hpyd  Helicobacter pylori oki128
Pathway
hpyd00020  Citrate cycle (TCA cycle)
hpyd00620  Pyruvate metabolism
hpyd01100  Metabolic pathways
hpyd01110  Biosynthesis of secondary metabolites
hpyd01120  Microbial metabolism in diverse environments
hpyd01130  Biosynthesis of antibiotics
hpyd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpyd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HPOKI128_00510
   00620 Pyruvate metabolism
    HPOKI128_00510
Enzymes [BR:hpyd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     HPOKI128_00510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 NAD_binding_8 Pyr_redox_3 Pyr_redox Lycopene_cycl Thi4 PEX-1N FAD_binding_2 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AHN37077
Position
complement(88945..90297)
Genome map
AA seq 450 aa AA seqDB search
MSMEFDAVIIGGGVSGCATFYTLSEYSSLKRVAIVEKCSKLAQISSSAKANSQTIHDGSI
ETNYTPEKAKKVRLSAYKTRQYALNKGLQNEVIFETQKMAIGVGDEECEFMKKRYESFKE
IFVGLEEFDKQKIKELEPNVILGANGIDRHENIIGHGYQKDWSTMNFAKLSENFVEEALK
LKPNNQVFLNFKVKKIEKRNDTYALISEDAEEVYAKFVLVNAGSYALPLAQSMGYGLDLG
CLPVAGSFYFVPDLLRGKVYTVQNPKLPFAAVHGDPDAVIKGKTRIGPTALTMPKLERNK
CWLKGISLELLKMDLNKDVFKIAFDLMSDKEIRNYVFKNMVFELPIIGKRKFLKDAQKII
PSLSLEDLEYAHGFGEVRPQVLDKTKRKLELGEKKICTHKGVTFNMTPSPGATSCLQNAL
VDSQEIAAYLGESFELERFYKDLSPEELEN
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggaatttgatgctgttattattggaggtggggtttcagggtgcgcgaccttt
tatactttgagcgaatacagctctctaaaacgtgtggctatcgtggaaaaatgctctaaa
ttagctcaaatcagctccagtgctaaggctaattcacaaaccattcatgatggctctatt
gaaacgaattacactcccgaaaaagctaaaaaagtgcgtttgagtgcttataagaccagg
caatacgcgctcaataaaggcttgcaaaatgaagtgatttttgaaacccagaaaatggct
ataggcgtgggcgatgaagaatgcgagttcatgaaaaaacgctacgaatcctttaaagaa
atctttgtggggttagaagaatttgacaaacaaaagattaaagaattagagcctaatgtg
attttaggggctaatggcatagacaggcatgaaaacattatcgggcatgggtatcaaaaa
gattggagcacgatgaattttgcgaagttgagtgaaaacttcgttgaagaagccctaaaa
ttaaagcctaacaaccaggtgtttttgaatttcaaagtgaaaaagattgaaaaacgcaac
gacacttacgcgctcatttcagaagacgctgaagaagtgtatgctaaattcgtgctggtc
aatgccggctcttacgctttgcctttggctcagagcatgggttatggcttggatttaggg
tgcttgcctgtggcgggcagcttttattttgtgccggatttattaaggggtaaggtttat
accgttcaaaaccccaagctcccttttgcagccgtgcatggcgaccctgatgccgtcatt
aaaggaaaaacacgaatcgggcctacggctttaacgatgcctaaattagaacgcaacaaa
tgctggcttaagggcattagcttggaattgttgaaaatggatttgaataaagatgtgttt
aagattgcgtttgatttgatgagcgataaagaaatccgtaattatgtgtttaaaaacatg
gtttttgaattgcccattatcggcaaaaggaaatttttaaaagacgctcaaaaaatcatc
ccctctcttagcctagaagatttagaatacgctcatggttttggcgaagtgcgcccgcaa
gttttagacaaaaccaagcgaaagctggaattaggcgaaaaaaagatttgcacccataaa
ggcgtcacttttaacatgaccccttctccaggcgcgacgagttgcttgcaaaacgccctt
gtggattcccaagaaatcgctgcgtatttgggcgagagctttgaattagagcgcttttat
aaagatttatccccagaagaactggaaaattaa

DBGET integrated database retrieval system