KEGG   Helicobacter pylori oki128: HPOKI128_05285Help
Entry
HPOKI128_05285    CDS       T03724                                 

Definition
(GenBank) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
hpyd  Helicobacter pylori oki128
Pathway
hpyd00430  Taurine and hypotaurine metabolism
hpyd00460  Cyanoamino acid metabolism
hpyd00480  Glutathione metabolism
hpyd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpyd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    HPOKI128_05285
   00460 Cyanoamino acid metabolism
    HPOKI128_05285
   00480 Glutathione metabolism
    HPOKI128_05285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hpyd01002]
    HPOKI128_05285
Enzymes [BR:hpyd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     HPOKI128_05285
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     HPOKI128_05285
Peptidases and inhibitors [BR:hpyd01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   HPOKI128_05285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AHN37916
Structure
PDB: 

Position
complement(1078281..1079984)
Genome map
AA seq 567 aa AA seqDB search
MRRSFLKTIGLGVIALSLGLLSPLSAASYPPIKNTKVGLALSSHPLASEIGQKVLEDGGN
AIDAAVAIGFALAVVHPAAGNIGGGGFAVIHLANGENVALDFREKAPLKATKNMFLDKQG
NVVPKLSEDGYLAAGVPGTVAGMEAMLKKYGTKKLSQLIDPAIKLAENGYAISQRQAETL
KEARERFLKYSSSKKYFFKKGHLDYQEGDLFVQKDLAKTLNQIKTLGAKGFYQGQVADLI
EKDMKKNGGIITKEDLASYNVKWRKPVVGSYRGYKIISMSPPSSGGTHLIQILNVMENAD
LSALGYGASKNIHIAAEAMRQAYADRSVYMGDADFVSVPVDKLINKAYAKKIFETIQPDT
VTPSSQIKPGMGQLHEGSNTTHYSVADRWGNAVSVTYTINASYGSAASIDGAGFLLNNEM
DDFSIKPGNPNLYGLVGGDANAIEANKRPLSSMSPTIVLKNNKVFMVVGSPGGSRIITTV
LQVISNVIDYNMNISEAVSAPRFHMQWLPDELRIEKFGMPADVKDNLTKMGYQIVTKPVM
GDVNAIQVLPKTKGSVFYGSTDPRKEF
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgagacggagttttttgaaaacgattggcttgggtgtgatagcgctctctttgggtttg
ttaagccctttgagtgcagcgagttacccccccattaaaaacactaaagtaggcttagcc
ctttctagccacccgctagctagtgagatcgggcaaaaggttttagaagatggaggtaat
gcgattgatgcggctgtagcgataggttttgctctagcggtcgtccatcctgcagcgggc
aatattggtggtgggggttttgcggttatccatttggctaatggtgaaaatgttgcccta
gattttagagaaaaagcccccttaaaagccaccaaaaacatgtttttagacaagcaaggc
aatgtagtccctaaactcagcgaagatggctatttggcggctggggttcctggaacggtg
gcgggcatggaggcgatgttgaaaaaatacggcacaaaaaaactatcgcaactcattgat
cctgccattaaattggctgaaaatggttatgcgatttcacaaagacaagcagaaacccta
aaagaagcaagggagcggtttttaaaatacagttctagcaaaaagtatttttttaaaaaa
ggccatcttgattatcaagaaggggatttgtttgtccaaaaagatttagccaagactttg
aatcaaatcaaaacgctaggtgctaaaggcttttatcaagggcaagtcgctgatcttatt
gagaaagacatgaaaaaaaatggagggattatcactaaagaagatttagccagttacaat
gtgaaatggcgcaaacctgtggtagggagttatcgtgggtataagatcatttctatgtcg
ccgccaagttcaggaggcacgcatttgatccagattttaaatgtcatggaaaatgcggat
ttaagcgctcttgggtatggggcttctaagaatatccatatcgctgcagaagcgatgcgc
caagcttatgcggacagatcggtttatatgggagacgctgattttgtttcagtgccggtg
gataaattgatcaataaggcgtatgccaaaaagatttttgaaactatccagccagatacg
gttacgccaagctctcaaatcaaaccaggaatggggcagttgcatgaggggagcaatacc
acgcattattctgtagcggacaggtgggggaatgcagtcagcgttacttacaccattaac
gcttcttatggaagtgctgctagtattgatggggcaggatttttattgaacaatgaaatg
gatgatttttccataaagcccgggaatcctaatctctatggtttagtagggggcgatgcg
aatgcgattgaagccaataagcgccctttaagctccatgtcgcctacaattgtgttgaaa
aacaataaggttttcatggtggtaggaagccctggagggtctaggattatcactacggtg
ttgcaagtgatttccaatgtcattgattacaacatgaatatttctgaagcggtctcagcc
cctagattccacatgcaatggttgcctgatgaattaaggattgaaaagtttggcatgccc
gctgatgtgaaagataacctcactaaaatgggctatcaaatcgttactaagccggtcatg
ggtgatgtgaatgcgatccaagttttgcctaaaactaaagggagcgttttctatggatca
acggatccaaggaaagaattttaa

DBGET integrated database retrieval system