KEGG   Helicobacter pylori oki128: HPOKI128_06540Help
Entry
HPOKI128_06540    CDS       T03724                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hpyd  Helicobacter pylori oki128
Brite
KEGG Orthology (KO) [BR:hpyd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HPOKI128_06540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 RnlB_antitoxin NnrS DUF1240
Motif
Other DBs
NCBI-ProteinID: AHN38126
Position
1330425..1332026
Genome map
AA seq 533 aa AA seqDB search
MEIKNIKEFEKASKKLQKDTLKIALALLFLIGAALLALIFGQANSKGLLLIFAAVIGGYM
AMNIGANDVSNNVGPAVGSKAISMGGAILIAGICEMLGAIIAGGEVVSTIKGRIVSPESI
NDAHVFINVMLASLLSGALWLHVATLIGAPVSTSHSVVGGIMGAGMAAAGMSAVNWHFLS
GIVASWVVSPLMGALIAMFFLMLIKKTIAYKEDKKSAALKVVPYLVALMSLTFSWYLIVK
VLKRLYALNFEIQLACGCILALLIFILFKRFVLKKAPQLENSHESINELFNIPLIFAAAL
LSFAHGANDVANAIGPLAAISQTLEDANSPMGNTLSSVPLWIMVVGAAGIALGLSLYGPK
LIKTVGSEITELDKMQAFCIALSAVITVLLASQLGLPVSSTHIVVGAVFGVGFLRERLRE
QSRRRFARIRDNIVAAHFGEDLEEIEGFLERFDKANLKEKSLMLESLKKSKNTAIALELK
KKEKKSLKKVYKEEVIKRSILKKIVTAWLVTVPVSALLGALLFVALGFIEKYF
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaaacatcaaggagtttgaaaaagcttctaaaaaactccaaaaagacacc
ttaaagatcgctctcgctcttttgttcctcattggcgctgctttgctcgctcttattttt
gggcaggctaattctaagggattgttgctcatttttgcggctgtgattggggggtatatg
gcgatgaatattggtgcgaatgatgtgtctaataatgtcggccctgccgtaggctctaaa
gccattagcatgggcggggcgattttgattgctgggatttgtgaaatgcttggagcgatc
attgctgggggggaagtggtttctacgattaagggccgtatcgtttcgcctgaatccatt
aatgatgcgcatgttttcattaatgtcatgttggctagccttttgagtggggcgttgtgg
ttgcatgtagccactttaataggcgctcctgtttccacttcacactctgtggtggggggg
attatgggggctggaatggcagcagctggaatgtctgctgtcaattggcattttttatca
ggtattgtggctagttgggtggtttcgcctttaatgggggctttgatagccatgtttttt
ttaatgctcattaaaaaaactatcgcttataaagaagataaaaagagcgcggctttaaag
gtcgtgccatatttggtagcgttgatgagcttaacattcagctggtatttgatcgttaag
gttttaaaacgcctctatgcactgaattttgaaatccagctggcttgcggctgtatcctt
gcacttttaatctttatcctttttaaaaggtttgtgttaaagaaagccccgcaactagaa
aatagccatgaaagcattaatgagcttttcaatatccctttgatttttgccgctgcgctt
ttaagctttgcgcatggggctaatgatgtggctaacgctataggcccactagcggccatc
agtcaaactttagaagatgcaaatagccctatggggaatactttaagctctgtgccgttg
tggattatggtagtaggggcagctgggattgctttaggcttgagtttgtatgggccaaag
ctcattaaaacggtgggctctgaaatcacagaattagacaaaatgcaagctttttgcatc
gcgctttctgcagtcatcaccgtgcttttagcctctcaattaggcttgcccgtaagctct
acgcatattgtggtgggcgcggtgtttggggtgggctttttaagagaacgcttaagagag
caatcaagaaggcgttttgctaggatcagagacaacattgtagcggcgcactttggggaa
gatttagaagaaattgaaggctttttagagcgctttgataaagccaatttgaaagaaaaa
tcgctcatgctagagagcttgaaaaaaagcaagaacaccgctatcgctttggaattgaaa
aagaaagaaaaaaagtcgcttaaaaaagtgtataaagaagaagtgatcaaacgctccatt
ttgaaaaagattgttaccgcttggcttgtaaccgtgccggtttctgcgcttttgggggcg
cttctttttgtggctcttggttttatagaaaagtatttctag

DBGET integrated database retrieval system