KEGG   Helicobacter pylori oki154: HPOKI154_06650Help
Entry
HPOKI154_06650    CDS       T03725                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
hpye  Helicobacter pylori oki154
Pathway
hpye03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hpye00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HPOKI154_06650
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hpye03011]
    HPOKI154_06650
Ribosome [BR:hpye03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HPOKI154_06650
  Bacteria
    HPOKI154_06650
  Archaea
    HPOKI154_06650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 ptaRNA1_toxin
Motif
Other DBs
NCBI-ProteinID: AHN39550
Position
complement(1322041..1322409)
Genome map
AA seq 122 aa AA seqDB search
MSKALLRFVRLSPTKARLIARQIQGMSAELAIASLEFTPNKAARVLSKVVASAVANGSLD
AKSALIVSCRVDAGPVLRRSIPRAKGRATAIRKPTSHVFVEVAEGKEMKSSKSHKKNQAE
GK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcgttattaagatttgtgcggttatctcctactaaagccagattgattgca
agacagattcaaggcatgagtgctgaattagcaatcgctagtttggaatttacgcccaat
aaagcggctagagtgctttcaaaagtggtggcttctgcggtcgctaacggctctttagac
gccaagagcgctctgattgtttcttgcagagtggatgctggccctgtgcttaggcgctcc
attccaagggctaaaggcagagccacagccattagaaagccaacatctcatgtattcgta
gaagtagcagaagggaaagaaatgaaatcttctaaaagccataaaaaaaatcaagcagaa
ggtaagtag

DBGET integrated database retrieval system