KEGG   Helicobacter pylori oki422: HPOKI422_03000Help
Entry
HPOKI422_03000    CDS       T03726                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
hpyf  Helicobacter pylori oki422
Pathway
hpyf00740  Riboflavin metabolism
hpyf00790  Folate biosynthesis
hpyf01100  Metabolic pathways
hpyf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpyf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    HPOKI422_03000
   00790 Folate biosynthesis
    HPOKI422_03000
Enzymes [BR:hpyf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     HPOKI422_03000
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     HPOKI422_03000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 NOD2_WH
Motif
Other DBs
NCBI-ProteinID: AHN40363
Position
591622..592656
Genome map
AA seq 344 aa AA seqDB search
MILKRVTEALEAYKNGEMLIVMDDEDRENEGDLVLAGIFSTPEKINFMATHARGLICVSL
TKDLAKKFELPPMVSVNDSNHETAFTVSIDAKEAKTGISAFERHLTIELLCKDTTKPSDF
VRPGHIFPLIAKDGGVLARTGHTEASVDLCKLAGLKPVSVICEIMKEDGSMARRGDKFLS
DFALKHNLKTLYVSDLISYRLENESLLKMFCQEEREFLKHQTQCYTFLDHQQKNHYAFKF
KGAKTHDLAPLVRFHPIKEDFDFLTTDAFEVFFKALEYLKREGGYLIFMNTHSKENNIVK
DFGIGALVLKNLGIKDFRLLSSSEDRQYKALSGFGLKLVETISL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgatcttaaaacgagttactgaagctttagaagcgtataaaaatggtgaaatgctcatt
gtcatggacgatgaagacagggaaaatgagggggatttggttttagccgggattttttct
actcctgagaaaatcaatttcatggccacgcatgctagggggttgatttgcgtgtctttg
accaaagatttagcgaaaaaatttgaattaccccctatggttagcgtgaatgattctaac
catgagaccgctttcacggtttctattgacgctaaagaagccaaaaccgggatttctgct
tttgaaaggcatttaacgattgaattattatgtaaagacaccaccaaaccgagcgatttt
gtgcgcccggggcatattttccctttaatcgcaaaagacgggggcgtgttagcgcgcacg
ggccatactgaagcgagcgtggatttatgcaaattagctggattaaaacccgtgagcgtg
atttgtgaaatcatgaaagaagatggatctatggcgaggagaggggataaatttttgagc
gactttgcccttaaacataaccttaaaaccctctatgtctctgatttgattagctatcgt
ttggaaaatgaaagtttgctgaaaatgttttgtcaagaagaaagagaatttttaaaacac
caaacgcaatgctacacttttttagaccaccagcaaaaaaaccattacgcttttaagttt
aaaggcgcaaaaacccatgatttagcccctttagtgcgtttccaccctatcaaagaggat
tttgatttcttgacgactgatgcgtttgaagtgttttttaaagcgttagaatatttaaag
cgcgaaggaggttatttgatctttatgaacacgcattctaaagaaaacaatatcgttaaa
gattttgggatcggagcgttggtgttaaaaaatttagggataaaggatttcaggctttta
agctcttctgaagacaggcagtataaggctttgagcgggtttgggcttaagcttgtagaa
acgattagcctttga

DBGET integrated database retrieval system