KEGG   Helicobacter pylori oki422: HPOKI422_03580Help
Entry
HPOKI422_03580    CDS       T03726                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpyf  Helicobacter pylori oki422
Pathway
hpyf00071  Fatty acid degradation
hpyf00072  Synthesis and degradation of ketone bodies
hpyf00280  Valine, leucine and isoleucine degradation
hpyf00310  Lysine degradation
hpyf00362  Benzoate degradation
hpyf00380  Tryptophan metabolism
hpyf00620  Pyruvate metabolism
hpyf00630  Glyoxylate and dicarboxylate metabolism
hpyf00640  Propanoate metabolism
hpyf00650  Butanoate metabolism
hpyf00900  Terpenoid backbone biosynthesis
hpyf01100  Metabolic pathways
hpyf01110  Biosynthesis of secondary metabolites
hpyf01120  Microbial metabolism in diverse environments
hpyf01130  Biosynthesis of antibiotics
hpyf01200  Carbon metabolism
hpyf01212  Fatty acid metabolism
hpyf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpyf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPOKI422_03580
   00630 Glyoxylate and dicarboxylate metabolism
    HPOKI422_03580
   00640 Propanoate metabolism
    HPOKI422_03580
   00650 Butanoate metabolism
    HPOKI422_03580
  Lipid metabolism
   00071 Fatty acid degradation
    HPOKI422_03580
   00072 Synthesis and degradation of ketone bodies
    HPOKI422_03580
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPOKI422_03580
   00310 Lysine degradation
    HPOKI422_03580
   00380 Tryptophan metabolism
    HPOKI422_03580
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPOKI422_03580
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPOKI422_03580
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HPOKI422_03580
Enzymes [BR:hpyf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPOKI422_03580
Exosome [BR:hpyf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPOKI422_03580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHN40468
Position
complement(709177..710352)
Genome map
AA seq 391 aa AA seqDB search
MNEVVIVAAKRSAVGSFLGSLKSVGAREMGVSVLKDALNASSLKPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDKNAFSVNMVCGSSMKAIQLAHDAIMLGRDEVVVCGGVENMSK
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDSFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASVIILCSAKKAQALGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttatagtggcggcaaaacgaagtgcggtggggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggtgttagcgtgcttaaagacgccttgaatgcg
agctctcttaagcctagcgatgtggattctgtcattttaggcaatgttttaggcgccggt
ttgggtcaaaatatcgccaggcagatccaactggacgccggcatccctaatgacaaaaac
gcttttagcgtcaatatggtttgtggatcgtcaatgaaagccattcaattagcgcatgat
gccatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaacatgagcaaa
gcaccctatttgtcgtttgacatgcgagatgggaaaagaatggggaatgcgaacatgata
gactccatgatccatgatggattgtgggatgctttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatagtttcgcgctc
caatcgcaactcaaagcaagagccgctattaatgcagggaaattccaagaagaaatcacg
cctattgaaatagcgaataaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gacacgacactagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcagggaattcatcagggatcaatgatggtgcgagtgttatcattttatgcagcgct
aaaaaagcgcaagcattggggttaaaaaccatggccactattaaggggtttggtttgggt
ggttgcagtccggatataatgggtatatgccctagcatcgctattaaaaacaaccttaaa
aatgtcaaaatgaatctcaacgacatcaatctttttgaactcaatgaagcctttgccgcg
caaagcatcgccgtgttaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggcgcgagcggcgctaggatattagtcacttta
ttgcatgaaatgaaaagaagcgggcatggtgtgggttgcgcgtcattgtgcgtgggcggc
ggtcaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system