KEGG   Helicobacter pylori oki673: HPOKI673_06495Help
Entry
HPOKI673_06495    CDS       T03727                                 

Definition
(GenBank) transcriptional regulator
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
hpyg  Helicobacter pylori oki673
Pathway
hpyg00730  Thiamine metabolism
hpyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpyg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    HPOKI673_06495
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hpyg03000]
    HPOKI673_06495
Enzymes [BR:hpyg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     HPOKI673_06495
Transcription factors [BR:hpyg03000]
 Prokaryotic type
  Other transcription factors
   Others
    HPOKI673_06495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AHN42425
UniProt: X2ICX8
Position
1304392..1305048
Genome map
AA seq 218 aa AA seqDB search
MQVSQYLYQNVQSIWGDCVSHPFVQGIGHGTLERDKFRFYIIQDYLFLLEYAKVFALGVV
KAYDEAVMREFSNAIQDILNNEMSIHNHYIRELQITQTELQNAHPTLANKSYTSYMLAEG
IKGSIKEVTAAVLACGWSYLVIAQNLSQIPNALEHAFYEHWIKGYSSKEFQACVSWNINL
LDSLTHASSKQEIEKLKDIFITTSKYEYMFWDMAYQKN
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtttcacaatatctgtatcaaaacgtgcaatctatttggggggattgtgtttcc
catccgtttgttcaaggcatagggcatgggactttagaaagagataaatttcgtttttat
atcattcaggattatttgtttcttttagaatacgctaaggtgtttgctttaggcgtagtt
aaagcttatgatgaagcggtgatgagagagttttctaacgctatacaagatattttgaat
aacgagatgagtatccataaccattacattagagaacttcaaatcactcaaacagaattg
caaaacgcgcaccccaccctcgctaataaatcctatacaagctacatgctcgctgaaggg
attaagggctctattaaagaagttacggcggctgttctggcttgtggctggagctattta
gtgatcgcgcaaaatttaagccaaatcccaaacgctttagaacatgccttttatgagcat
tggattaagggctatagctccaaagaatttcaagcgtgtgtgtcgtggaatattaatttg
cttgattccctcactcacgcttcttcaaaacaagaaattgagaagctaaaggacattttt
atcactacaagtaaatatgaatacatgttttgggatatggcgtatcaaaaaaactaa

DBGET integrated database retrieval system