KEGG   Helicobacter pylori oki828: HPOKI828_01165Help
Entry
HPOKI828_01165    CDS       T03728                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hpyh  Helicobacter pylori oki828
Pathway
hpyh00900  Terpenoid backbone biosynthesis
hpyh01100  Metabolic pathways
hpyh01110  Biosynthesis of secondary metabolites
hpyh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpyh00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPOKI828_01165
Enzymes [BR:hpyh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HPOKI828_01165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-ProteinID: AHN42935
Position
218129..219235
Genome map
AA seq 368 aa AA seqDB search
MVVLGSTGSIGKNALKIAKKFKVKIEALSCGKNIALINEQIKVFKPKKVAILNPNDLNAL
EPLGAEVFVGLDGIDAMIEECVSNLVINAIVGVAGLGASFKSLQTNKKLALANKESLVSA
GHLLDISQITPIDSEHFGLWALLQNKALKPKSLIISASGGAFRDTPLEFIPVQNAQNALK
HPNWSMGSKITIDSASMVNKLFEILETYWLFGASLKIDALIERSSIVHALVEFEDNSIIA
HLASTDMQLPISYAINPKLASLSASIKPLDLYALSAIKFEPISMERYTLWRYKDLLLENP
KLGVVLNASNEVAMEKFLNQEIAFGGLIKTISQALESYAKMPFKLSNLDEVLALDREVRE
RFGSVARV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggttgttttaggaagcaccggctctattgggaaaaacgccctaaaaatcgcaaaaaaa
ttcaaggtaaaaatagaagccttgagctgtgggaaaaatatcgctttaatcaatgagcaa
atcaaagttttcaaacccaagaaagtagcgatcttaaatcctaacgatttgaatgcttta
gagcctttgggtgcggaagtgtttgtggggctagatggcattgatgcgatgatagaagag
tgcgtttcaaatttagtcattaacgccattgtgggcgtggctggattaggggcaagcttt
aaaagcttacaaactaacaaaaaactagccctggcgaataaagagagtttagtgagcgcg
gggcatttgttagacatttcacaaatcacgcccattgatagcgagcattttggtttgtgg
gcgttgttgcaaaacaaggctttaaagcctaaatccttaatcattagcgcaagtgggggg
gctttcagggacacgcctttagagttcattcctgttcaaaacgcgcaaaacgcgctcaag
caccctaattggagcatgggatctaaaatcactattgattcagcgagcatggtcaataag
ctttttgaaatcctagaaacttattggctttttggcgcgtctttaaagattgatgcgctg
attgaaaggagttctatcgtgcatgctttggtggagtttgaagataactctatcatcgcg
catttggcaagcacggacatgcaattacccataagctatgccattaaccctaaattagct
tctttgagcgcgtctatcaagcccctagatttatacgctttaagcgcgattaaatttgaa
cccattagcatggagcgctacactttgtggcgttataaagacttgttgttggaaaaccca
aagcttggcgtggtgctgaatgcgagcaatgaagtggcgatggagaagtttttaaatcaa
gagatcgcttttggtgggcttatcaaaaccatttctcaagccctagaatcatacgctaaa
atgcctttcaagctttctaatttagatgaagtgctggcgttggatagggaagttagggag
cgttttggaagtgtagcgagagtgtag

DBGET integrated database retrieval system