KEGG   Helicobacter pylori oki828: HPOKI828_03510Help
Entry
HPOKI828_03510    CDS       T03728                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpyh  Helicobacter pylori oki828
Pathway
hpyh00071  Fatty acid degradation
hpyh00072  Synthesis and degradation of ketone bodies
hpyh00280  Valine, leucine and isoleucine degradation
hpyh00310  Lysine degradation
hpyh00362  Benzoate degradation
hpyh00380  Tryptophan metabolism
hpyh00620  Pyruvate metabolism
hpyh00630  Glyoxylate and dicarboxylate metabolism
hpyh00640  Propanoate metabolism
hpyh00650  Butanoate metabolism
hpyh00900  Terpenoid backbone biosynthesis
hpyh01100  Metabolic pathways
hpyh01110  Biosynthesis of secondary metabolites
hpyh01120  Microbial metabolism in diverse environments
hpyh01130  Biosynthesis of antibiotics
hpyh01200  Carbon metabolism
hpyh01212  Fatty acid metabolism
hpyh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPOKI828_03510
   00630 Glyoxylate and dicarboxylate metabolism
    HPOKI828_03510
   00640 Propanoate metabolism
    HPOKI828_03510
   00650 Butanoate metabolism
    HPOKI828_03510
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPOKI828_03510
   00072 Synthesis and degradation of ketone bodies
    HPOKI828_03510
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPOKI828_03510
   00310 Lysine degradation
    HPOKI828_03510
   00380 Tryptophan metabolism
    HPOKI828_03510
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPOKI828_03510
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPOKI828_03510
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPOKI828_03510
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpyh04147]
    HPOKI828_03510
Enzymes [BR:hpyh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPOKI828_03510
Exosome [BR:hpyh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPOKI828_03510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHN43352
Position
703171..704346
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGAVVLKDALKASGLKPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQRKARVAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAQKAQKLGLKTMAAIRGFGLGGCSPDIMGICPSIAIRNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSAHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgcagtggggagttttttaggctct
ctaaagagcgttggtgctagagaaatgggcgctgtcgtgcttaaagacgctttgaaggcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttatccgctggt
ttgggtcaaaatatcgccagacagatccaactggacgctggcataccgaatgataggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgat
agcatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggagaatatgagtgca
gcgccttatttgtcgtttgacatgcgagatgggaaaagaatggggaatgcgaacatgata
gattccatgatccatgacggattatgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgctttcgcgctc
caatcgcaacgcaaagcaagagtcgccattaatgcagggaaattccaagaagagatcacg
cccattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgacactagaatcccttgcaaagctcaaaccagctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcgct
caaaaagcgcaaaaattggggttaaaaacaatggcggctatcagggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattagaaacaatcttaaa
aatgtcaaaatgaatctcaacgacatcaatctttttgaactcaatgaagccttcgccgcg
caaagcatagccgtgttaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggcgcgagtggtgctaggattttagtaacttta
ttgcatgaaatgaaaagaagtgctcatggcgtgggctgtgcgtcattgtgtgtgggtggc
ggacaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system