KEGG   Helicobacter pylori oki828: HPOKI828_04075Help
Entry
HPOKI828_04075    CDS       T03728                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
hpyh  Helicobacter pylori oki828
Pathway
hpyh00740  Riboflavin metabolism
hpyh00790  Folate biosynthesis
hpyh01100  Metabolic pathways
hpyh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpyh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    HPOKI828_04075
   00790 Folate biosynthesis
    HPOKI828_04075
Enzymes [BR:hpyh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     HPOKI828_04075
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     HPOKI828_04075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 NOD2_WH
Motif
Other DBs
NCBI-ProteinID: AHN43454
Position
complement(817604..818638)
Genome map
AA seq 344 aa AA seqDB search
MILKRVTEALEAYKNGEMLIVMDDEDRENEGDLVLAGIFSTPEKINFMATHARGLICVSL
TKDLANKFELPPMVSVNDSNHETAFTVSIDAKEAKTGISAFERHLTIELLCKDTTKPSDF
VRPGHIFPLIAKDGGVLARTGHTEASVDLCKLAGLKPVSVICEIMKEDGSMARRGDKFLS
DFALKHNLKTLYVSDLISYRLENESLLKMFCQEEREFLKHQTQCYTFLDHQQKNHYAFKF
KGAKTNDLAPLVRFHPIKEDFDFLTTGAFEVFFKALEYLKCEGGYLIFMNTHAKENNIVK
DFGIGALVLKNLGIKDFRLLSSSEDRQYKALSGFGLKLVETISL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgatcttaaaacgagttactgaagctttagaagcgtataaaaatggcgaaatgcttatt
gttatggacgatgaagacagagaaaatgagggggatttggttttagccgggattttttcc
acccctgagaaaatcaatttcatggccacgcatgctagggggttgatttgcgtgtctttg
accaaagatttagcgaataagtttgaattaccccctatggtgagcgtgaatgattctaac
catgagaccgctttcacggtttccattgacgccaaagaagccaaaaccgggatttctgct
tttgaaaggcatttaacgattgaattattgtgtaaagataccaccaagcctagcgatttt
gtgcgcccggggcatattttccctttaatcgccaaagatggaggcgtgttagcgcgcacg
ggccatactgaagcgagcgtggatttatgcaaattagccggattaaagcccgtgagcgtg
atttgtgaaatcatgaaagaagacggctctatggcgaggagaggggataaatttttgagc
gattttgccctaaagcacaacctcaaaaccctctatgtttctgatttgattagctatcgt
ttagaaaacgaaagtttgctgaaaatgttttgccaagaagaaagggaatttttaaaacac
caaacgcaatgctacacttttttagaccaccagcaaaaaaaccattacgcttttaagttt
aagggtgcaaaaaccaatgatttagcccctttagtgcgtttccaccctatcaaagaggat
tttgattttttaacgactggcgcgtttgaagtgttttttaaagcgttagaatatttaaag
tgcgaagggggctatttgatctttatgaacacgcatgctaaagaaaacaatatcgttaaa
gattttgggattggggcgttagtgctaaaaaatttggggataaaggatttcaggctttta
agctcttctgaagacaggcagtataaggctttgagcgggtttgggcttaagcttgtagaa
acgattagcctttaa

DBGET integrated database retrieval system