KEGG   Helicobacter pylori oki828: HPOKI828_04325Help
Entry
HPOKI828_04325    CDS       T03728                                 

Definition
(GenBank) anti-codon nuclease masking agent (prrB)
  KO
K01154  type I restriction enzyme, S subunit [EC:3.1.21.3]
Organism
hpyh  Helicobacter pylori oki828
Brite
KEGG Orthology (KO) [BR:hpyh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:hpyh02048]
    HPOKI828_04325
Enzymes [BR:hpyh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     HPOKI828_04325
Prokaryotic defense system [BR:hpyh02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   HPOKI828_04325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methylase_S
Motif
Other DBs
NCBI-ProteinID: AHN43498
Position
complement(863071..863667)
Genome map
AA seq 198 aa AA seqDB search
MHKIERLLQTLAPKGVEFRKLGEVCEILDNRRIPIAKNKRNPGIYPYYGANGIQDYIDSY
IFDGDFVLVGEDGSVINKDNTPVVNWASGKIWVNNHAHVLQTKNELKLKFLYFYLQTIDV
SYCVAGTPPKINQENLKKITIPIPPLEIQQEIVKILDQFLALTTDLLAGIPAEIEARKKQ
YEYYREKLLAFKPLPNKA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaatagagcgcttactccaaactttagcgcctaagggggtggagtttaggaaa
ttgggggaggtgtgtgaaattttagataatcggcgtatcccaattgcgaaaaataaaaga
aatccaggaatttatccttattatggagcaaatgggattcaagattatattgatagctat
atttttgatggggattttgtgctagttggtgaagatgggagcgttatcaataaggataat
actcctgttgtgaattgggcaagcggaaaaatatgggtgaacaatcatgctcatgtgctt
caaacaaaaaatgaactaaaattaaagtttttgtatttttatttacaaacgatagatgtt
agctattgtgttgctggaactccgccaaaaatcaaccaagaaaatttaaaaaaaatcaca
atccccatcccacccctagaaatccaacaagagatcgttaagattttggatcaatttttg
gctctaaccaccgatttattagccggtatcccggctgaaatagaagccaggaaaaagcaa
tacgaatattacagagaaaaactattggctttcaaaccactcccaaacaaggcataa

DBGET integrated database retrieval system