KEGG   Helicobacter pylori oki828: HPOKI828_07830Help
Entry
HPOKI828_07830    CDS       T03728                                 

Definition
(GenBank) mannose-6-phosphate isomerase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
hpyh  Helicobacter pylori oki828
Pathway
hpyh00051  Fructose and mannose metabolism
hpyh00520  Amino sugar and nucleotide sugar metabolism
hpyh01100  Metabolic pathways
hpyh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HPOKI828_07830
   00520 Amino sugar and nucleotide sugar metabolism
    HPOKI828_07830
Enzymes [BR:hpyh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     HPOKI828_07830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2
Motif
Other DBs
NCBI-ProteinID: AHN44090
Position
complement(1559343..1560755)
Genome map
AA seq 470 aa AA seqDB search
MKIKNILLSGGSGKRLWPLSRSLYPKQFLKLFGNESLFKLSFKRNASLVDETLIVCNEKH
YFLALEEIESEIKNKSVGFLLESLSKNTANAIALSALMSEREDLLIVTPSDHLIKDIQAY
ENAMKKAIDLAQKGFLVTFGINIEKPNTEFGYIESPNGLDVKRFIEKPSLEKAIEFQKSG
GFYFNSGMFVFQAGVFLDELKKHAPAILKGCERAFESLERASFFEKKIARLSEKSMQDLE
DVSVDIALMQQSHKIKMVGLNAKWSDLGNFNALFEEVANEPKENVSLNQTPIFAKESQNN
LVFSHKVSALLGVEDLAIIDTKDALLIAHKDKAKDLKALVSEVETNNQELLQTHTKVYRP
WGSYEVLHESGCYKVKILEVKPNARLSLQKHFHRSEHWVVISGMASVELDRQSFELQANE
STYIPKNTLHRLANYGKIPLIIIEVQVGEYVGEDDIVRVDDDFNRQNQGK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaaaatatcttactgagtggggggagcgggaaacgcctatggcctttaagc
cgtagcctataccctaagcaatttttaaagctttttggcaatgaaagcttgtttaaattg
agttttaaaagaaatgcttctttagtggatgaaacgctcattgtgtgcaacgaaaagcat
tattttttagccctagaagaaatagagagtgaaatcaaaaacaaaagcgtgggtttttta
ttagagagtttgagtaaaaacaccgctaacgccatcgctttgagtgctttaatgagcgag
agggaagatttgctcatcgttacgccaagcgatcatttgattaaagacattcaagcgtat
gaaaatgcaatgaaaaaagcgattgatttagcccaaaaaggctttttagtcacttttggg
atcaatattgaaaagcccaacacggagtttgggtatattgaaagccctaatggtttagac
gtcaagcgcttcattgaaaagccaagcctagaaaaagcgatagagtttcaaaaaagcggg
ggtttttatttcaatagcggcatgtttgttttccaagcgggcgtttttttagacgaattg
aaaaagcatgcccctgctattttaaaggggtgcgaaagagcgtttgaatctttggagagg
gcgtctttttttgaaaaaaagatcgctcgtttaagcgaaaagagcatgcaagatttagaa
gatgtgagcgtggatatagctttaatgcaacaaagccacaaaatcaaaatggtaggatta
aacgccaaatggagcgatttagggaattttaacgctctttttgaagaagtggctaacgag
cctaaagaaaatgtcagcctgaatcaaacgcctatttttgccaaagagagccagaataat
ttagttttttcccataaagtgagcgctcttttaggggttgaggatttagccattattgac
actaaagacgctcttttaatcgctcataaagacaaggctaaagatttaaaagctttagtg
agcgaggtagaaacaaacaaccaagaattgctgcaaacgcacactaaagtgtatcgtcct
tgggggagctatgaagtcttgcatgagagcgggtgttacaaggttaagattttagaagtc
aagcctaacgcaaggctttctttgcaaaagcatttccacaggagcgaacactgggtggtg
attagcgggatggcgagcgtggagttggatcgccaatcgtttgaattgcaagctaacgaa
tccacttatatccctaaaaacaccttacaccgcttggctaattatggcaaaatcccttta
atcatcatagaagttcaagtgggcgagtatgtcggtgaagacgatattgtaagggttgat
gatgattttaacagacaaaatcaaggaaaataa

DBGET integrated database retrieval system