KEGG   Helicobacter pylori UM037: K750_05275Help
Entry
K750_05275        CDS       T02659                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
hpyi  Helicobacter pylori UM037
Pathway
hpyi00780  Biotin metabolism
hpyi01100  Metabolic pathways
Module
hpyi_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:hpyi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    K750_05275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hpyi01007]
    K750_05275
Enzymes [BR:hpyi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     K750_05275
Amino acid related enzymes [BR:hpyi01007]
 Aminotransferase (transaminase)
  Class II
   K750_05275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase SWI2_SNF2
Motif
Other DBs
NCBI-ProteinID: AGL69999
UniProt: R4Q9H2
Position
549513..550634
Genome map
AA seq 373 aa AA seqDB search
MFSKSLEALRHAKRYRKRELFDPSLKDYASNDYLGLSVKKDLLQNAFNKLQSFVSHSPKA
SMLVNGYHSLHAELEERLADLLGFESALLVGSGFLGNLALIDTLLVKNALLFMDEHYHAS
GIFSTKTKSDQVVFFSHNNAKDLQQKLFNAPKNKLKFIAIEGVYSMDASIAPYNFYTITQ
ETPNAFLIVDEAHSFGTIGENLLGFLEYYRIKEKDKIIKLSTFSKALASYGACILAPLQT
IEFLTNRAKSVIYTTALSLLDTALTLAHLEYFIAQKQELKNELSKHQQIIFETLGVRTLA
GFFTLEFENNPALLNAHHFLKEKGFLVGAIRPPTVSKPLLRVSLSLKNSLEDTKELANTL
LNYSKIQYSFKSG
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgttttctaaatctttagaagccctacgccatgccaaacgctaccgcaaaagagagttg
tttgacccttcattaaaggattacgcttctaatgattatttgggtttgagcgttaaaaaa
gatttgcttcaaaacgcttttaataagctccaatcctttgtttctcattcccccaaggct
tccatgctagtgaatggctaccactctttgcatgcagaattggaagaacgattagcggat
ttgttggggtttgaaagcgctcttttagtggggagtggttttttgggcaatctggcttta
atagatacccttttagtcaaaaacgccctcttattcatggacgaacactaccatgcaagc
gggatttttagcactaaaaccaagtctgatcaagtggtttttttctcgcacaataacgct
aaagatttacaacaaaaactctttaacgctcctaaaaataaactcaaattcatagccatt
gagggggtttattctatggatgcgagcatcgctccctataatttttatacaatcactcaa
gagactcctaacgcttttttaatcgttgatgaagcccatagttttgggactatcggcgag
aatttattgggttttttagaatattatcgcatcaaagaaaaagacaaaatcattaaactc
agcactttctctaaagcgcttgcgagctatggggcgtgtattttagcccctttacaaacc
atagagtttttaactaatcgcgctaaaagcgtgatttatactaccgctttaagcctgtta
gacaccgctttaactttggcccatttagaatactttatcgcgcaaaaacaagaattaaaa
aatgagcttagcaaacaccaacagattatttttgaaaccttaggcgttagaacgctcgca
ggattttttactttagagtttgaaaataatcccgctcttttaaacgctcatcattttttg
aaagaaaaagggtttttagtgggggctatccgcccccccacggtttctaaacccctttta
cgagtctctttgtccctcaaaaacagcctagaagacactaaagagcttgcgaacaccctt
ttaaattattctaaaatacaatattcttttaagagtggttaa

DBGET integrated database retrieval system