KEGG   Helicobacter pylori UM037: K750_05730Help
Entry
K750_05730        CDS       T02659                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpyi  Helicobacter pylori UM037
Pathway
hpyi00071  Fatty acid degradation
hpyi00072  Synthesis and degradation of ketone bodies
hpyi00280  Valine, leucine and isoleucine degradation
hpyi00310  Lysine degradation
hpyi00362  Benzoate degradation
hpyi00380  Tryptophan metabolism
hpyi00620  Pyruvate metabolism
hpyi00630  Glyoxylate and dicarboxylate metabolism
hpyi00640  Propanoate metabolism
hpyi00650  Butanoate metabolism
hpyi00900  Terpenoid backbone biosynthesis
hpyi01100  Metabolic pathways
hpyi01110  Biosynthesis of secondary metabolites
hpyi01120  Microbial metabolism in diverse environments
hpyi01130  Biosynthesis of antibiotics
hpyi01200  Carbon metabolism
hpyi01212  Fatty acid metabolism
hpyi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpyi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    K750_05730
   00630 Glyoxylate and dicarboxylate metabolism
    K750_05730
   00640 Propanoate metabolism
    K750_05730
   00650 Butanoate metabolism
    K750_05730
  09103 Lipid metabolism
   00071 Fatty acid degradation
    K750_05730
   00072 Synthesis and degradation of ketone bodies
    K750_05730
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    K750_05730
   00310 Lysine degradation
    K750_05730
   00380 Tryptophan metabolism
    K750_05730
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    K750_05730
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    K750_05730
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    K750_05730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpyi04147]
    K750_05730
Enzymes [BR:hpyi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     K750_05730
Exosome [BR:hpyi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   K750_05730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGL70090
UniProt: R4QHC1
Position
complement(440621..441796)
Genome map
AA seq 391 aa AA seqDB search
MNEVVIVAAKRSAVGSFLGSLKSVGAREMGVCVLKDALNASGLKPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDKNAFSVNMVCGSSMKAIQLAHDSIMLGRDEMVVCGGVENMSM
APYLSFDMREGKRMGNTNMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDNFAL
QSQLKARAAINAKKFQEEITPIEIANKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCNAKKAQALGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSLAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttatagtggcggcaaaacggagtgctgtagggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggtgtttgcgtgcttaaagacgctttgaatgcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttaggtgctggt
ttgggtcaaaatatcgctaggcagatccaactagacgccggtatccctaatgacaaaaac
gctttcagcgtcaatatggtttgcggatcgtctatgaaagctatccagttagcgcatgac
agcatcatgcttgggcgcgatgagatggtggtgtgcggtggcgtggaaaacatgagcatg
gcaccttatttgtcgtttgacatgcgagaggggaaaagaatggggaatactaacatgata
gactccatgatccatgatggattgtgggatgctttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacataagccgagaagagcaagataatttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcaaagaaattccaagaagaaatcacg
cctattgaaatagcgaataaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gacacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcagggaattcatcagggatcaatgatggcgcgagtattatcattttatgcaatgct
aaaaaagcgcaagcattggggttaaaaaccatggccactatcaaggggtttggtttgggt
ggttgcagtccggatataatgggtatatgccctagtattgcgattaaaaacaaccttaaa
aatgtcaaaatgaatctcaacgacatcaatctttttgaactcaatgaagcctttgccgcg
caaagcctagccgtgttaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggcgcaatagccattggccaccctattggcgcgagcggtgctaggatcttagtcacttta
ttgcatgaaatgaaaagaagcgggcatggcgtgggttgcgcgtcattgtgtgtgggtggc
ggtcaagggctatcagtggtagttgaacaaaaataa

DBGET integrated database retrieval system