KEGG   Helicobacter pylori UM037: K750_06770Help
Entry
K750_06770        CDS       T02659                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hpyi  Helicobacter pylori UM037
Pathway
hpyi00450  Selenocompound metabolism
hpyi00970  Aminoacyl-tRNA biosynthesis
hpyi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpyi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    K750_06770
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    K750_06770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hpyi01007]
    K750_06770
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hpyi03016]
    K750_06770
Enzymes [BR:hpyi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     K750_06770
Amino acid related enzymes [BR:hpyi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   K750_06770
Transfer RNA biogenesis [BR:hpyi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    K750_06770
 Prokaryotic type
   Other AARSs
    K750_06770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e SAC3_GANP
Motif
Other DBs
NCBI-ProteinID: AGL70285
UniProt: R4QHX8
Position
232567..234522
Genome map
AA seq 651 aa AA seqDB search
MQKSLITTPIYYVNDIPHIGHAYTTLIADTLKKYYTLQGEEVFFLTGTDEHGQKIEQSAR
LRNQSPKAYADSISAIFKNQWDFFNLDYDGFIRTTDSEHQKCVQNAFEIMFEKGDIYKGT
YSGYYCVSCESYCAISKADNTNDKVLCPDCLRETVLLEEESYFFRLSAYEKPLLEFYAKN
PEAILPIYRKNEVTSFIEQGLLDLSITRTSFEWGIPLPKKMNDPKHVVYVWLDALLNYAS
ALGYLNDLDNKMAHFERARHIVGKDILRFHAIYWPAFLMSLNLPLFKQLCVHGWWTIEGV
KMSKSLGNVLDAQKLAMEYGIEELRYFLLREVPFGQDGDFSKKALIERINANLNNDLGNL
LNRLLGMAKKYFNYSLKSAKITAYYSKELEKVHQILDNANSFVPKMQLHKALEELFNVYD
FLNKLIAKEEPWVLHKNNESEKLEALLSLIANALLQSSFLLYAFMPKSAAKLASAFHTEI
TPNNYERFFKAKKLQDMILQDTEPLFSKMEKIEKAEKGGEALLKENQEKEKKDRKEKAPP
TQENYIGIEDFKKVEIKVGLIKEAQRIEKSNKLLRLKVDLGENRLRQIISGIALDYEPES
LVGQMVCVVANLKPAKLMGEMSEGMILAVRDSDNLALISPTREKIAGSLIS
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatcactgatcacaacccccatttattatgtgaatgacatccctcatattggt
catgcttatacgactttgattgcggacactctaaagaagtattacacgcttcaaggcgaa
gaagtcttttttttaaccggcaccgatgagcatgggcagaaaatcgaacaaagtgcgaga
ctaaggaatcaaagccctaaagcttacgccgatagcattagcgcgatttttaaaaaccag
tgggattttttcaatttagattatgatggttttatccgcaccacagacagcgagcatcaa
aaatgcgtgcaaaacgcctttgaaatcatgtttgaaaaaggggatatttataaaggcact
tatagtgggtattattgcgtgagctgtgagagttattgcgcgatttctaaagcggacaat
acgaacgataaagtcttatgccctgattgcttgagggagactgtgcttttagaagaagag
agctatttttttagattgagcgcgtatgaaaagcctttattggagttttacgctaaaaac
cctgaagcgattttgcctatttatcgtaaaaatgaggtaacttcttttattgagcagggt
ttattggatctgtctatcacgcgcacgagctttgaatggggcattcctttgcctaaaaaa
atgaacgatcctaaacatgtggtgtatgtttggttggacgctttattgaattatgcgagc
gcgttagggtatttgaatgatttagacaataaaatggcgcattttgaacgcgctaggcat
attgtgggtaaggatattttacgcttccatgccatttattggccggcttttttaatgagt
ttgaatttgcccctattcaaacagctttgcgtgcatgggtggtggacgatagagggcgtg
aaaatgagtaagagcttgggtaatgttttagacgctcaaaagctcgctatggagtatgga
attgaagaattacgctattttttattgcgtgaggtgccttttgggcaggatggggatttt
tctaaaaaagcgttaatagaaaggatcaatgcgaatttgaataacgatttgggaaatttg
ttgaaccgcttgctaggcatggctaaaaaatatttcaattattctctaaaaagcgccaaa
atcaccgcttattattctaaagagctagaaaaagtgcatcaaattttagataacgctaat
tcttttgtgcctaaaatgcaattgcataaagctttagaggaattgtttaacgtttatgat
tttttaaacaaactcatcgctaaagaagagccgtgggttttgcacaaaaacaacgaatca
gaaaaactagaagccttattgagtttgatcgcaaacgcgcttttgcaatcaagctttttg
ctttatgcgttcatgccaaagagcgcggctaaattagcgagcgcttttcatacagaaatc
acgcccaataattacgaacgcttttttaaggctaaaaaattacaagatatgattttacaa
gacaccgagcctttattttccaaaatggagaaaattgaaaaggctgaaaaagggggagaa
gccctactaaaagaaaatcaagaaaaagaaaaaaaagatagaaaagaaaaagccccacca
acacaagaaaactatatcggcattgaggatttcaaaaaagtagaaattaaagtagggctt
atcaaagaagctcaaaggattgaaaaatctaataaattactgcgcttaaaagtggattta
ggcgaaaatcgtttgaggcagatcatctcagggatcgctttggattatgagcctgaaagt
ttggtggggcaaatggtgtgcgtggtggctaatttaaaacccgcaaaactcatgggcgaa
atgagtgagggcatgattttagcggtgcgagatagcgataatctagccttaatcagccct
actagagaaaaaattgcaggaagtttgatcagctaa

DBGET integrated database retrieval system