KEGG   Helicobacter pylori oki898: HPOKI898_03585Help
Entry
HPOKI898_03585    CDS       T03729                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpyj  Helicobacter pylori oki898
Pathway
hpyj00071  Fatty acid degradation
hpyj00072  Synthesis and degradation of ketone bodies
hpyj00280  Valine, leucine and isoleucine degradation
hpyj00310  Lysine degradation
hpyj00362  Benzoate degradation
hpyj00380  Tryptophan metabolism
hpyj00620  Pyruvate metabolism
hpyj00630  Glyoxylate and dicarboxylate metabolism
hpyj00640  Propanoate metabolism
hpyj00650  Butanoate metabolism
hpyj00900  Terpenoid backbone biosynthesis
hpyj01100  Metabolic pathways
hpyj01110  Biosynthesis of secondary metabolites
hpyj01120  Microbial metabolism in diverse environments
hpyj01130  Biosynthesis of antibiotics
hpyj01200  Carbon metabolism
hpyj01212  Fatty acid metabolism
hpyj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpyj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPOKI898_03585
   00630 Glyoxylate and dicarboxylate metabolism
    HPOKI898_03585
   00640 Propanoate metabolism
    HPOKI898_03585
   00650 Butanoate metabolism
    HPOKI898_03585
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPOKI898_03585
   00072 Synthesis and degradation of ketone bodies
    HPOKI898_03585
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPOKI898_03585
   00310 Lysine degradation
    HPOKI898_03585
   00380 Tryptophan metabolism
    HPOKI898_03585
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPOKI898_03585
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPOKI898_03585
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPOKI898_03585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpyj04147]
    HPOKI898_03585
Enzymes [BR:hpyj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPOKI898_03585
Exosome [BR:hpyj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPOKI898_03585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHN44830
Position
complement(712752..713927)
Genome map
AA seq 391 aa AA seqDB search
MNEVVIVAAKRSAVGSFLGSLKSVGAREMGVSVLKDALNASSLKPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDKNAFSVNMVCGSSMKAIQLAHDAIMLGRDEVVVCGGVENMSK
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDSFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASVIILCSAKKAQALGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttatagtggcggcaaaacgaagtgcggtggggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggtgttagcgtgcttaaagacgccttgaatgcg
agctctcttaagcctagcgatgtggattctgtcattttaggcaatgttttaggcgccggt
ttgggtcaaaatatcgccaggcagatccaactggacgccggcatccctaatgacaaaaac
gcttttagcgtcaatatggtttgtggatcgtcaatgaaagccattcaattagcgcatgat
gccatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaacatgagcaaa
gcaccctatttgtcgtttgacatgcgagatgggaaaagaatggggaatgcgaacatgata
gactccatgatccatgatggattgtgggatgctttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatagtttcgcgctc
caatcgcaactcaaagcaagagccgctattaatgcagggaaattccaagaagaaatcacg
cctattgaaatagcgaataaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gacacgacactagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcagggaattcatcagggatcaatgatggtgcgagtgttatcattttatgcagcgct
aaaaaagcgcaagcattggggttaaaaaccatggccactattaaggggtttggtttgggt
ggttgcagtccggatataatgggtatatgccctagcatcgctattaaaaacaaccttaaa
aatgtcaaaatgaatctcaacgacatcaatctttttgaactcaatgaagcctttgccgcg
caaagcatcgccgtgttaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggcgcgagcggcgctaggatattagtcacttta
ttgcatgaaatgaaaagaagcgggcatggtgtgggttgcgcgtcattgtgcgtgggcggc
ggtcaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system