KEGG   Helicobacter pylori oki898: HPOKI898_03795Help
Entry
HPOKI898_03795    CDS       T03729                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
hpyj  Helicobacter pylori oki898
Pathway
hpyj00860  Porphyrin and chlorophyll metabolism
hpyj00970  Aminoacyl-tRNA biosynthesis
hpyj01100  Metabolic pathways
hpyj01110  Biosynthesis of secondary metabolites
hpyj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpyj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPOKI898_03795
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HPOKI898_03795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hpyj01007]
    HPOKI898_03795
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hpyj03016]
    HPOKI898_03795
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:hpyj02048]
    HPOKI898_03795
Enzymes [BR:hpyj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     HPOKI898_03795
Amino acid related enzymes [BR:hpyj01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   HPOKI898_03795
Transfer RNA biogenesis [BR:hpyj03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HPOKI898_03795
 Prokaryotic Type
   Other AARSs
    HPOKI898_03795
Prokaryotic defense system [BR:hpyj02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    HPOKI898_03795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1b
Motif
Other DBs
NCBI-ProteinID: AHN44866
Position
complement(764012..765331)
Genome map
AA seq 439 aa AA seqDB search
MLRFAPSPTGDMHIGNLRAAIFNYIVAKQQHKPFLIRIEDTDKERNIEGKDQEILEILKL
MGISWDKLVYQSHNIDYHREMAEKLLKENKAFYCYASAEFLEREKEKAKNEKRPFRYLDE
WATLEKDKHHAPVVRLKAPNHAVSFNDAIKKEVRFEPDELDSFVLLRKDKSPTYNFACAC
DDLLYEISLIIRGEDHVSNTPKQILIQQALGSNDPIVYVHLPIILDETSGKKMSKRDEAS
SVKWLLNQGFLPVAIANYLITIGNKVPKEVFSLDEAIEWFDLENLSSSPAHFNLKYLKHL
NHEHLKLLDDEKLLELTSIKDKNLLGLLRLFIEECGTLLELKEKISLFLEPKDIVKTYEN
EDFKERCLTLFNALKSMDFQAYKDFESFKKEAMRLSQLKGKDFFKPLRILLTGNSHGVEL
PLIFPYIQSHHQEVLRLKA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgttttgcgccttcgcctacaggggatatgcacatagggaatttaagggcagcc
attttcaactacattgtggccaaacagcaacacaaaccctttctcattcgcattgaagac
acggacaaagagcgtaacattgaaggcaaagatcaagagattttagagattttaaagctt
atggggataagttgggacaagctcgtgtatcaaagccataacatagattaccacagagaa
atggcagaaaaattactgaaagaaaataaagcattttattgttatgcgagcgcggagttt
ttagaaagagaaaaagaaaaagccaaaaatgaaaaacgccctttcaggtatttagacgaa
tgggccactttagaaaaagacaagcaccatgcccctgtggtgcgtttaaaagccccaaat
catgcggtgtctttcaacgatgcgattaaaaaagaagtgagatttgaacctgatgaattg
gattcttttgtgcttttgagaaaagataaaagccctacttataatttcgcttgcgcatgc
gatgatttgctctatgaaatcagtttgattattagaggcgaagatcatgtgagtaacacc
cctaaacaaattttaatccagcaagctttaggctcaaacgatccgattgtttatgtgcat
ttgcccattattttagatgaaacaagcggtaaaaagatgagcaaaagagatgaagcgtcc
agcgtgaaatggcttttgaatcaagggtttttaccggttgcgatcgcaaattacctcatc
actatcggtaataaagtgcctaaggaagtttttagccttgatgaagcgatagagtggttt
gatttagaaaatctttccagttccccggctcattttaatttaaaatatttaaaacactta
aaccacgagcatttaaagcttttagacgatgaaaagctattagaactcacttcaataaaa
gataaaaaccttttagggcttttaagattgtttatagaagaatgcggcacgcttttagaa
ttgaaagaaaaaatttcgttgtttttagagccaaaggatattgttaaaacttacgagaac
gaagattttaaagagcgttgtttaacgctttttaacgctctaaaaagcatggattttcaa
gcgtataaggattttgaaagttttaaaaaggaagccatgcgattaagccagcttaagggt
aaggattttttcaaacctttgcgcatccttttaaccgggaactcgcatggcgttgaattg
cctttgattttcccctatatccaaagccatcatcaagaagttttaaggctcaaagcatga

DBGET integrated database retrieval system