KEGG   Helicobacter pylori Aklavik86: HPAKL86_01595Help
Entry
HPAKL86_01595     CDS       T02353                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
hpyk  Helicobacter pylori Aklavik86
Pathway
hpyk00020  Citrate cycle (TCA cycle)
hpyk00620  Pyruvate metabolism
hpyk01100  Metabolic pathways
hpyk01110  Biosynthesis of secondary metabolites
hpyk01120  Microbial metabolism in diverse environments
hpyk01130  Biosynthesis of antibiotics
hpyk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpyk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HPAKL86_01595
   00620 Pyruvate metabolism
    HPAKL86_01595
Enzymes [BR:hpyk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     HPAKL86_01595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 NAD_binding_8 Pyr_redox_3 Lycopene_cycl Pyr_redox FAD_binding_2 Thi4 Amino_oxidase PEX-1N K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AFX89338
UniProt: K7Y8E9
Position
complement(302765..304117)
Genome map
AA seq 450 aa AA seqDB search
MSMEFDAVIIGGGVSGCATFYTLSEYSSLKRVAIVEKCSKLAQISSSAKANSQTIHDGSI
ETNYTPEKAKKVRLSAYKTRQYALNKGLQNEVIFETQKMAIGVGDEECEFMKKRYESFKE
IFVGLEEFDKQKIKELEPNVILGANGADRHENIIGHGYQKDWSTMNYAKLSENFVEEALK
LKPNNQVFLNFKVKKIEKRNDTYAVISEDAEEVYAKFVLVNAGSYALPLAQSMGYGMDLG
CLPVAGSFYFVPDLLRGKVYTVQNPKLPFAAVHGDPDAVIKGKTRIGPTALAMPKLERNK
CWLKGISLELLKMDLNKDVFKIAFDLMSDKEIRNYVLKNMVFELPIIGKRKFLKDAQKII
PSLSLEDLEYAHGFGEVRPQVLDKTKRKLELGEKKICTHKGITFNMTPSPGATSCLQNAL
VDSQEIAAYLGESFELERFYKDLSPEELEN
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggaatttgatgccgtgattattggaggtggggtttcagggtgcgcgaccttt
tataccctaagcgaatacagctctttaaagcgcgtggctattgtggaaaaatgctctaaa
ttagctcaaatcagctccagcgctaaggctaattcgcaaaccattcatgatggctctatt
gaaacgaattacactccagaaaaagctaaaaaagtgcgtttgagcgcttataagaccaga
caatacgcgctcaataaaggcttgcaaaatgaagtgatctttgaaacccaaaaaatggcc
ataggcgtgggcgatgaagaatgcgagttcatgaaaaaacgctacgaatcctttaaagaa
atctttgtggggttagaagaatttgacaaacaaaagattaaagaattagagcctaatgtg
attttaggggctaatggcgcagataggcatgaaaacattatcgggcatgggtatcaaaaa
gattggagcacgatgaattacgcgaagttgagtgaaaacttcgttgaagaagccctaaaa
ttaaagcctaacaaccaggtgtttttgaatttcaaagtgaaaaagattgaaaaacgcaac
gacacttacgccgtaatttcagaagacgctgaagaagtgtatgctaaattcgtgctggtc
aatgccggctcttacgctttgcctttggctcagagcatgggctatggcatggatttaggg
tgcttgcctgtggcgggtagcttttattttgtgccggatttattaaggggtaaggtttat
accgttcaaaaccctaaactcccttttgcagccgtgcatggcgaccctgatgctgtcatt
aaaggaaaaacacgaatcgggcctactgctttagcgatgcctaaattagaacgtaacaaa
tgctggcttaagggcattagcttggaattgttgaaaatggatttgaataaagatgtgttt
aaaattgcgtttgatttgatgagcgataaagaaatccgtaattatgtgcttaaaaacatg
gtttttgaattgcccattatcggtaaaaggaaatttttaaaagacgctcaaaaaatcatc
ccctctcttagcctagaagatttagaatacgctcatggttttggcgaagtgcgcccgcaa
gttttagacaaaaccaagcgaaagctggaattaggcgaaaaaaagatttgcacccataaa
ggcatcactttcaacatgactccctctccaggcgcgacgagttgcttgcaaaacgctctt
gtggattcccaagaaatcgctgcgtatttgggtgagagctttgaattagaacgcttttat
aaagatttatccccagaagaattggaaaattaa

DBGET integrated database retrieval system