KEGG   Helicobacter pylori Aklavik86: HPAKL86_02755Help
Entry
HPAKL86_02755     CDS       T02353                                 

Definition
(GenBank) D,D-heptose 1,7-bisphosphate phosphatase
  KO
K03273  D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC:3.1.3.82 3.1.3.83]
Organism
hpyk  Helicobacter pylori Aklavik86
Pathway
hpyk00540  Lipopolysaccharide biosynthesis
hpyk01100  Metabolic pathways
Module
hpyk_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:hpyk00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPAKL86_02755
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpyk01005]
    HPAKL86_02755
Enzymes [BR:hpyk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.82  D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
     HPAKL86_02755
    3.1.3.83  D-glycero-alpha-D-manno-heptose 1,7-bisphosphate 7-phosphatase
     HPAKL86_02755
Lipopolysaccharide biosynthesis proteins [BR:hpyk01005]
 Unusual sugar
  HPAKL86_02755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like HAD_2 PNK3P Hydrolase Acid_phosphat_B
Motif
Other DBs
NCBI-ProteinID: AFX89563
UniProt: K7Y960
Position
571858..572382
Genome map
AA seq 174 aa AA seqDB search
MSTTNKALFLDRDGIINIDKGYVSQKEDFEFQKGIFELLNHAKSLGYKLLLITNQSGINR
GYYTLKDFENLTEYLQENLLKELGFNLDGIYFCRHAPEENCACRKPKPFLILQAAKEHQI
CLERSFMIGDKESDMLAGLNAKVKNNLLLTTNVLKTPHSWIQCKDFKEMIDLIK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccactaacaaagccctttttttggacagagacggcattatcaatattgataaa
ggctatgtgagtcaaaaagaagattttgagtttcaaaaagggatttttgaattactaaac
catgcgaaatctttaggctacaaattgcttttaatcaccaaccaatccgggatcaaccgg
ggctattacacccttaaagattttgagaatctcaccgaataccttcaagaaaacttgctt
aaagaattaggttttaatttggatggcatctatttttgcaggcacgccccagaagaaaat
tgtgcttgcagaaagccaaagccctttttgattttgcaagccgctaaagagcatcaaatt
tgcttggagcgatcttttatgataggcgataaggagagcgacatgttagccggcttgaac
gctaaagtcaaaaacaaccttttattgaccacaaatgttttaaaaactcctcattcttgg
atacaatgtaaagattttaaagagatgatagatctaatcaaataa

DBGET integrated database retrieval system